BioLiP

>protein
MPFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVL
IYLVALAARCHVDLPQAVISKMDTNRQRYPVHL

The query sequence (length=113) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6sqw:A	114	113	1.0000	0.9912	1.0000	9.99e-81	2oig:B, 2oig:A, 2oig:D, 6sqw:D, 6sqy:A, 6sqy:D, 6sqz:A, 6sqz:D
2	7mu5:A	110	108	0.8584	0.8818	0.8981	2.60e-68	7mu5:E, 7mu5:B, 7mu5:H, 7mu5:C, 7mu5:D, 7mu5:F, 7mu5:G
3	4qgp:A	108	100	0.2920	0.3056	0.3300	1.39e-15	4qgp:B
4	2q5z:B	94	80	0.2212	0.2660	0.3125	7.18e-04	2q5z:A, 2q73:A, 2q73:B, 2q73:C, 2q73:D, 2q9l:A, 2q9l:B, 2q9l:C, 2q9l:D
5	5ie9:C	95	80	0.2035	0.2421	0.2875	0.016	5ie9:A, 5ie9:B, 5ie9:D
6	4gc9:A	318	79	0.1770	0.0629	0.2532	0.15	7pnt:c
7	7ody:C	100	34	0.1239	0.1400	0.4118	0.31	7ody:A, 7ody:B, 7ody:D
8	8hku:L18P	193	78	0.1504	0.0881	0.2179	0.45	8hkv:L18P, 8hky:L18P, 8hkz:L18P, 8hl1:L18P, 8hl2:L18P, 8hl3:L18P, 8hl4:L18P, 8hl5:L18P
9	9f2k:A	513	22	0.0973	0.0214	0.5000	1.6
10	1p4r:A	589	42	0.1150	0.0221	0.3095	3.4	1p4r:B, 1pkx:A, 1pkx:C, 1pl0:A, 1pl0:B, 1pl0:C, 1pl0:D, 5uy8:A, 5uy8:B, 5uy8:C, 5uy8:D, 5uz0:A, 5uz0:B, 5uz0:C, 5uz0:D
11	4dl8:A	224	33	0.0885	0.0446	0.3030	6.4	4dk4:A, 4dk4:B, 4dkb:A, 4dlc:A
12	4ry8:B	321	19	0.0885	0.0312	0.5263	7.2	4ry8:A, 4ry8:C, 4ry8:D
13	4k0x:A	243	68	0.1681	0.0782	0.2794	7.6	4jf4:A, 4jf4:B, 4k0w:A, 6n6u:A, 6n6v:A, 6n6x:A, 6n6y:A, 7t7d:A, 7t7e:A, 7t7f:A, 7t7g:A, 5wi3:B, 5wi3:A, 5wi7:A, 5wi7:B, 5wib:A, 5wib:B, 4x55:A, 4x55:B
14	3frh:A	241	32	0.1062	0.0498	0.3750	8.4	3b89:A, 3fri:A
15	5euf:B	416	35	0.0973	0.0264	0.3143	9.7	5euf:A

[Back]