BioLiP

>protein
MNYWWVSQKQTFKQEFEGGYMWSPKENKNGTQSHYYNNMTLVQPGDVVFSFANGLILSVGIARSHAYSYNKPTEFGVAGA
DWANDGWKIDLEYHLVENKIRPKAHIDFIRPYLPQKYSPLQDNGNGNQAYLFSVPHELASKVVELIGSEAEEVIFGFADT
TEITTTADAIECQISNDASIDETEKHQLVKSRRGQGIFRSRLEQVESRCRVTGVQLKNHLIASHIKPWAVSNNQERLDGH
NGLLLAPHVDHLFDKGFISFEDNGEMIVSEKLNLDVLKAWSISQGNYGYFSKQQQEYMCYHRENVFKKL

The query sequence (length=309) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6yjb:A	309	309	1.0000	1.0000	1.0000	0.0	6ykf:A, 6ymg:A, 6ymg:B
2	2hhl:C	184	94	0.0777	0.1304	0.2553	0.32	2hhl:A, 2hhl:D
3	7ane:aa	1514	33	0.0388	0.0079	0.3636	2.3
4	1t9z:A	181	82	0.0712	0.1215	0.2683	3.5	6du2:A, 6du2:B, 6du3:A, 6du3:B, 2ghq:A, 2ghq:B, 2ght:A, 2ght:B, 3l0b:A, 3l0c:A, 3l0c:B, 3l0y:A, 3l0y:B, 3pgl:A, 3pgl:B, 1ta0:A, 4ygy:A, 4ygy:B, 4yh1:A, 4yh1:B
5	1ghe:B	171	49	0.0453	0.0819	0.2857	4.4	1ghe:A, 1j4j:A, 1j4j:B
6	6tgh:A	410	83	0.0744	0.0561	0.2771	7.3	6tgh:C, 6tgh:B, 6tgh:D, 6ti1:A, 6ti1:C, 6ti3:A, 6ti3:C, 6ti3:B, 6ti3:D, 6ti4:A, 6ti4:C, 4wxf:A, 4wxf:C, 4wxg:A, 4wxg:C, 6yrw:A, 6yrw:C, 6yrw:B, 6yrw:D
7	1akl:A	470	52	0.0550	0.0362	0.3269	8.6	1jiw:P, 1kap:P, 3vi1:A, 3vi1:B
8	5jph:B	144	58	0.0615	0.1319	0.3276	9.2	5jph:A, 5jph:C
9	2fj0:A	530	90	0.0615	0.0358	0.2111	10.0

[Back]