MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVW
DSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNIAALPWVNFDSFNLNVANFT
DYFAPIITMAKYQQEGDRLLLPLSVQVHHAVCDGFHVARFINRLQELCNSKLK
The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1cia:A | 213 | 213 | 0.9906 | 0.9906 | 0.9906 | 2.20e-161 | 1cla:A, 2cla:A, 3cla:A, 4cla:A, 1qca:A, 6x7q:A, 6x7q:B, 6x7q:C |
2 | 1q23:B | 217 | 208 | 0.4554 | 0.4470 | 0.4663 | 6.25e-71 | 1q23:A, 1q23:C, 1q23:D, 1q23:E, 1q23:F, 1q23:G, 1q23:H, 1q23:I, 1q23:J, 1q23:K, 1q23:L, 3u9f:A, 3u9f:B, 3u9f:C, 3u9f:D, 3u9f:E, 3u9f:F, 3u9f:G, 3u9f:H, 3u9f:I, 3u9f:J, 3u9f:K, 3u9f:L, 3u9f:M, 3u9f:N, 3u9f:O, 3u9f:P, 3u9f:R, 3u9f:S |
3 | 8dqo:B | 437 | 31 | 0.0563 | 0.0275 | 0.3871 | 0.043 | 8dqo:A, 8dqp:A, 8dqp:B, 8dqq:A, 8dqq:B, 8dqr:A |
4 | 1eaf:A | 243 | 30 | 0.0704 | 0.0617 | 0.5000 | 0.089 | |
5 | 4f1n:B | 853 | 70 | 0.1033 | 0.0258 | 0.3143 | 1.8 | |
6 | 2oox:E | 333 | 69 | 0.1174 | 0.0751 | 0.3623 | 5.0 | 2oox:G, 2ooy:G, 2ooy:E, 2qr1:G, 2qr1:E, 2qrc:G, 2qrc:E, 2qrd:G, 2qrd:E, 2qre:G, 2qre:E |
7 | 5fal:A | 435 | 28 | 0.0516 | 0.0253 | 0.3929 | 7.8 | 5fan:A, 4kec:A |