MNWIVATFMLMFVLVAFLPLVVSLAYTWVTNP
The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8hju:Y | 32 | 32 | 1.0000 | 1.0000 | 1.0000 | 4.90e-16 | 8hjv:Y, 8j5o:Y, 8j5p:Y |
| 2 | 8fun:D | 370 | 27 | 0.3438 | 0.0297 | 0.4074 | 2.9 | 8ful:B, 8ful:D, 8ful:F, 8ful:H, 8fum:B, 8fum:D, 8fum:F, 8fum:H, 8fun:B, 8fuo:B, 8fuo:D, 6m2i:B |
| 3 | 6m1w:B | 346 | 27 | 0.3438 | 0.0318 | 0.4074 | 2.9 | |
| 4 | 5xtc:r | 459 | 25 | 0.3438 | 0.0240 | 0.4400 | 3.7 | 5xtd:r, 5xth:r, 5xti:r, 5xti:Br |
umich.edu