MNSRMKIKKAYEYMKSFHQHDTTGHDIAHVERVYNNACYIAKRENITDTLVIELSSLLHDTVDSKLTDEILAYDQLKQFL
STLDLSSEISQQVLYIIKHMSHVKLSIDGEIVRDADRLDAIGAIGIARTFQFSGHFGEPMWTETKLSNEELHTSLVEELD
NSAIKHFYEKLFKLKDLMHTPTAKKLAEERHQFMIQYLKQFMSEWNFNK
The query sequence (length=209) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2qgs:A | 209 | 209 | 1.0000 | 1.0000 | 1.0000 | 2.61e-157 | 2qgs:B |
2 | 5dqw:A | 188 | 194 | 0.3828 | 0.4255 | 0.4124 | 5.81e-45 | 5dqw:B |
3 | 3djb:A | 188 | 201 | 0.3971 | 0.4415 | 0.4129 | 2.17e-41 | 3djb:B |
4 | 3b57:A | 180 | 180 | 0.2967 | 0.3444 | 0.3444 | 2.79e-27 | |
5 | 2pq7:A | 174 | 202 | 0.2775 | 0.3333 | 0.2871 | 7.22e-18 | |
6 | 2q2a:A | 241 | 59 | 0.0909 | 0.0788 | 0.3220 | 0.58 | 2pvu:A, 2q2a:B, 2q2a:C, 2q2a:D, 2q2c:A, 2q2c:B, 2q2c:C, 2q2c:D |
7 | 7rcz:A | 511 | 28 | 0.0526 | 0.0215 | 0.3929 | 2.2 | 7rcz:B |
8 | 3gxq:B | 54 | 59 | 0.0766 | 0.2963 | 0.2712 | 8.9 | 3gxq:A |