MNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFT
ASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVR
The query sequence (length=130) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7yiu:D | 153 | 130 | 1.0000 | 0.8497 | 1.0000 | 8.58e-93 | 7cqi:A, 7cqk:A, 6m4o:A, 7yiy:D |
2 | 7yjk:D | 156 | 126 | 0.4154 | 0.3462 | 0.4286 | 8.84e-28 | 7yjk:H, 7yjm:D, 7yjn:D, 7yjo:D |
3 | 8iaj:D | 182 | 132 | 0.4000 | 0.2857 | 0.3939 | 8.50e-20 | 8iaj:H, 8iam:D, 8iam:H, 8qof:A, 8qof:E, 8qog:A |
4 | 8c80:A | 184 | 131 | 0.3769 | 0.2663 | 0.3740 | 1.09e-19 | 8c81:A, 8c82:A, 8c82:E |
5 | 8h1r:D | 789 | 59 | 0.1231 | 0.0203 | 0.2712 | 0.63 | 8h1r:A, 5iva:A |
6 | 7rjt:A | 902 | 124 | 0.2385 | 0.0344 | 0.2500 | 1.7 | 7rjt:B, 7rjt:C, 7rjt:D, 7rk6:A, 7rk6:B, 7rk6:C, 7rk6:D, 5tj6:A |