MNRKWEAKLKQIEERAEEPPSIWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRKNLLHC
YEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLDSSTDEKFSRHLIFQLHDVAF
KDNIHVGNFLRKILQPALDLLPDLSFLVVKNNMGEKHLFVDLGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKD
VSDEYQYFLSSLVSNVRFSDTLRILTCEP
The query sequence (length=269) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5l2x:A | 271 | 271 | 1.0000 | 0.9926 | 0.9926 | 0.0 | 7jk1:A, 7jk1:B, 7jkl:A, 7jkl:B, 7jkp:A, 7jkp:B, 7jl8:A, 7jl8:B, 7jlg:A, 7jlg:B, 5l2x:B |
2 | 7s9v:A | 1296 | 100 | 0.1041 | 0.0216 | 0.2800 | 0.33 | |
3 | 5wtk:A | 1215 | 101 | 0.1190 | 0.0263 | 0.3168 | 1.8 | 7dmq:A |
4 | 6hzn:A | 743 | 45 | 0.0595 | 0.0215 | 0.3556 | 2.1 | |
5 | 7w3u:A | 343 | 161 | 0.1413 | 0.1108 | 0.2360 | 3.1 | 7w3r:A, 7w3u:B, 7w3u:C |
6 | 8tj5:0 | 1246 | 23 | 0.0483 | 0.0104 | 0.5652 | 4.5 | 8tj5:Y |
7 | 6okp:K | 133 | 18 | 0.0372 | 0.0752 | 0.5556 | 5.3 | 7ugo:N, 7ugp:M, 7ugp:N |
8 | 6ieq:H | 231 | 17 | 0.0372 | 0.0433 | 0.5882 | 6.2 | 5cey:D, 8d50:H, 6mug:H, 6nnf:H, 5t3s:H, 5t3x:H, 8tgo:O, 8tgo:f, 7ucf:H |