MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFG
QRLDLPAIIGMMLICAGVLIINLLSRSTPH
The query sequence (length=110) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8uoz:A | 110 | 110 | 1.0000 | 1.0000 | 1.0000 | 1.85e-75 | 7jk8:A, 7jk8:B, 7mgx:A, 7mgx:B, 7mgx:E, 7mgx:F, 7sfq:A, 7sfq:B, 7ssu:A, 7ssu:B, 7sv9:B, 7sv9:A, 7svx:B, 8uoz:B |
2 | 7szt:A | 104 | 86 | 0.3091 | 0.3269 | 0.3953 | 1.63e-12 | 8tgy:A, 8tgy:E, 8vxu:A, 8vxu:B, 8vxu:C, 8vxu:D, 6wk8:B, 6wk8:A, 6wk9:B, 6wk9:A, 6wk9:F, 6wk9:E |
3 | 5sy1:A | 582 | 87 | 0.2273 | 0.0430 | 0.2874 | 2.8 | 5sy1:B |
4 | 6fhw:B | 587 | 24 | 0.0636 | 0.0119 | 0.2917 | 5.9 | 6fhw:A |
5 | 2f57:B | 300 | 87 | 0.1545 | 0.0567 | 0.1954 | 6.8 | |
6 | 6dte:B | 340 | 33 | 0.1273 | 0.0412 | 0.4242 | 8.9 | 6dte:A, 4mss:A, 4mss:B, 5utp:A, 5utp:B, 5utq:A, 5utq:B, 5utr:A, 5utr:B |