MNLTIPFAKGHATENDFIIIPDEDARLDLTPEMVVTLCDRRAGIGADGILRVVKAADVEGSTVDPSLWFMDYRNADGSLA
EMCGNGVRLFAHWLYSRGLVDNTSFDIGTRAGVRHVDILQADQHSAQVRVDMGIPDVTGLSTCDINGQVFAGLGVDMGNP
HLACVVPGLSASALADMELRAPTFDQEFFPHGVNVEIVTELEDDAVSMRVWERGVGETRSCGTGTVAAACAALADAGLGE
GTVKVCVPGGEVEVQIFDDGSTLTGPSAIIALGEVQIHHH
The query sequence (length=280) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5m47:A | 280 | 280 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 3ejx:D | 301 | 294 | 0.3857 | 0.3588 | 0.3673 | 1.38e-35 | 3ejx:A, 3ejx:B, 3ejx:C, 3ejx:E, 3ejx:F, 3ekm:A, 3ekm:B, 3ekm:C, 3ekm:D, 3ekm:E, 3ekm:F |
3 | 2gke:A | 274 | 268 | 0.3107 | 0.3175 | 0.3246 | 1.51e-30 | 2gkj:A |
4 | 8f4r:B | 1033 | 90 | 0.0893 | 0.0242 | 0.2778 | 2.7 |