BioLiP

>protein
MNLLQHIAQSRQQLRKSELKVADHVLNDPASVMHSSMAELAHGVGVSEPTIVRFCRAIGCSGFQDLKLKLAQSLAAGASF
GQFSIHESDSVADFSLKIFDTTLHSLMEVREHLDTHALERAIAAIAHAQRVEFYGFGASGAVASDAQHKFFRLLLSAAAY
SDPHMQAMSAVTLKPSDVAICISQSGRSKDLLITANLVREAGATLITLCPSQTPLADLATVNLAIDVHEDTDIYTPLTSR
IAHLVVIDVLAMGVAMARGPDLVNHLKSVKRSLRSLRLSPK

The query sequence (length=281) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8k3b:A	281	281	1.0000	1.0000	1.0000	0.0	8ju9:A
2	4ivn:A	264	250	0.2278	0.2424	0.2560	3.70e-20	4ivn:B
3	7en7:A	191	161	0.1779	0.2618	0.3106	2.14e-14	7en5:A, 7en6:D
4	8tx9:A	190	154	0.1459	0.2158	0.2662	2.72e-06	8tx9:B, 8tx9:C, 8tx9:D
5	3iwf:A	89	73	0.0783	0.2472	0.3014	7.17e-06
6	8fdb:B	333	73	0.0854	0.0721	0.3288	0.003	8eym:A, 8eym:B, 8fdb:A
7	6cin:B	1169	52	0.0534	0.0128	0.2885	0.39	6cin:A, 6cin:C, 6cin:D, 6cin:E, 6cin:F, 6cio:A, 6cio:B, 6cio:C, 6cio:D, 6cio:E, 6cio:F, 6cip:A, 6cip:B, 6cip:C, 6cip:D, 6cip:E, 6cip:F, 6ciq:A, 6ciq:B, 6ciq:C
8	2wt0:A	300	28	0.0463	0.0433	0.4643	1.3	2wsv:A, 2wt1:A, 2wt2:A, 2wt2:B
9	8smp:A	527	57	0.0641	0.0342	0.3158	1.3	8smn:A
10	5v4a:A	268	82	0.0676	0.0709	0.2317	2.8	5v4a:B
11	6f4a:A	644	32	0.0534	0.0233	0.4688	4.7
12	6f3h:B	790	29	0.0498	0.0177	0.4828	5.4	6f3h:A
13	1i0r:A	161	45	0.0463	0.0807	0.2889	6.7	1i0s:A
14	4o1e:A	271	39	0.0605	0.0627	0.4359	7.3	4o1e:B, 4o1f:A, 4o1f:B

[Back]