MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKR
The query sequence (length=385) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
1jkj:B |
388 |
385 |
1.0000 |
0.9923 |
1.0000 |
0.0 |
1cqi:B, 1cqi:E, 1cqj:E, 1cqj:B, 1jkj:E, 1jll:E, 1jll:B, 2nu6:E, 2nu6:B, 2nu7:E, 2nu7:B, 2nu8:E, 2nu8:B, 2nu9:E, 2nu9:B, 2nu9:I, 2nu9:G, 2nua:E, 2nua:B, 1scu:E, 1scu:B, 2scu:E, 2scu:B |
2 |
2fp4:B |
393 |
392 |
0.4494 |
0.4402 |
0.4413 |
1.11e-106 |
2fpg:B, 7jfp:B, 7jkr:B, 7jmk:B, 7msr:B, 6wcv:B |
3 |
3ufx:B |
378 |
361 |
0.4442 |
0.4524 |
0.4737 |
1.53e-105 |
3ufx:E, 3ufx:G, 3ufx:I |
4 |
6no5:A |
239 |
239 |
0.2338 |
0.3766 |
0.3766 |
5.43e-42 |
6no0:A, 6no0:B, 6no1:A, 6no2:A, 6no2:B, 6no3:A, 6no3:B, 6no4:A, 6no5:B, 6no5:C, 6no5:D |
5 |
6hxq:B |
410 |
392 |
0.3013 |
0.2829 |
0.2959 |
3.94e-31 |
|
6 |
6hxj:A |
336 |
205 |
0.1377 |
0.1577 |
0.2585 |
7.21e-08 |
6hxj:C, 6hxj:E, 6hxj:G |
7 |
6qfb:C |
1011 |
307 |
0.2104 |
0.0801 |
0.2638 |
5.97e-06 |
|
8 |
8g1e:A |
1037 |
309 |
0.2104 |
0.0781 |
0.2621 |
1.08e-04 |
8g1e:B, 8g1e:D, 8g1e:C, 8g1f:A, 8g1f:C, 8g1f:B, 8g1f:D, 8g5c:A, 8g5c:B, 8g5c:C, 8g5c:D, 8g5d:A, 8g5d:B, 8g5d:C, 8g5d:D, 6hxh:A, 6hxh:B, 6hxh:C, 6hxh:D, 6hxh:E, 6hxh:F, 6hxh:G, 6hxh:H, 6hxk:A, 6hxk:B, 6hxk:C, 6hxk:D, 6hxl:A, 6hxl:B, 6hxl:C, 6hxl:D, 6hxl:E, 6hxl:F, 6hxl:G, 6hxl:H, 6hxm:A, 6hxm:B, 7liw:B, 7liw:D, 7lj9:A, 7lj9:B, 7lj9:C, 7lj9:D, 7lla:A, 7lla:C, 7lla:B, 7lla:D, 3mwe:A, 6o0h:A, 6o0h:B, 6o0h:C, 6o0h:D, 3pff:A, 6poe:B, 6poe:D, 6poe:A, 6poe:C, 6qfb:A, 6qfb:B, 6qfb:D, 7rig:A, 7rig:C, 7rig:B, 7rig:D, 7rkz:A, 7rkz:C, 7rkz:B, 7rkz:D, 7rmp:A, 7rmp:C, 7rmp:B, 7rmp:D, 5tde:A, 5tde:B, 5tdf:A, 5tdm:A, 5tdm:B, 5tdz:A, 5te1:A, 5te1:B, 5teq:A, 5teq:B, 5tes:A, 5tet:A, 6ui9:A, 6ui9:C, 6ui9:B, 6ui9:D, 6uia:C, 6uia:A, 6uia:D, 6uia:B, 6uuw:A, 6uuw:C, 6uuw:B, 6uuw:D, 6uuz:A, 6uuz:C, 6uuz:B, 6uuz:D, 6uv5:A, 6uv5:C, 6uv5:B, 6uv5:D, 6z2h:A, 6z2h:C, 6z2h:D |
9 |
6hxi:C |
410 |
405 |
0.2623 |
0.2463 |
0.2494 |
0.066 |
6hxi:A, 6znw:A |
10 |
4xym:B |
229 |
71 |
0.0571 |
0.0961 |
0.3099 |
3.8 |
4xym:D, 4xz3:B, 4xz3:D, 4y8v:B, 4y8v:D, 4yb8:B, 4yb8:D, 4ybz:D |
11 |
2yw2:A |
423 |
48 |
0.0468 |
0.0426 |
0.3750 |
4.9 |
2yw2:B |
12 |
8eug:a |
147 |
34 |
0.0364 |
0.0952 |
0.4118 |
7.0 |
8esq:a, 8eui:a |