MNLEPPKAECRSATRVMGGPCTPRKGPPKCKQRQTRQCKSKPPKKGVQGCGDDIPGMEGCGTDITVICPWEACNHCELHE
LAQYGIC
The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 2ju4:A | 87 | 87 | 1.0000 | 1.0000 | 1.0000 | 4.28e-60 | |
| 2 | 8ufj:B | 444 | 21 | 0.1264 | 0.0248 | 0.5238 | 2.5 | 8tfb:A, 8tfb:B, 8tfb:C, 8tfb:D, 8tfb:L, 8tfb:M, 8tfb:O, 8tfb:P, 8tfb:Q, 8tfb:V, 8tfb:X, 8tfb:Y, 8tfk:A, 8tfk:B, 8tfk:C, 8tfk:D, 8tfk:E, 8tfk:F, 8tfk:G, 8tfk:H, 8tfk:I, 8tfk:J, 8tfk:K, 8tfk:L, 8ufj:A, 8ufj:C |
umich.edu