BioLiP

>protein
MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKKGDALQLVGFGTFKVNHRAERAANVPAFVSGKALKDAVK

The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6oaj:B	79	79	0.9605	0.9241	0.9241	1.94e-45	6o6k:A, 6o8q:A, 6o8q:I, 6oaj:C, 4yey:C, 4yf0:A, 4yfh:A
2	6o8q:B	91	90	0.9737	0.8132	0.8222	2.84e-44	6o8q:G, 6o8q:H, 6o8q:F, 4yf0:B, 4yfh:B
3	4yew:C	71	76	0.9079	0.9718	0.9079	1.86e-42	6o6k:B, 6oaj:D, 4yex:C, 4yft:C
4	4qju:A	90	90	0.5526	0.4667	0.4667	6.54e-21	4qju:B
5	1p71:A	94	89	0.4605	0.3723	0.3933	5.36e-15	1p51:A, 1p51:B, 1p51:D, 1p51:C, 1p71:B, 1p78:A, 1p78:B
6	8flj:F	94	90	0.3421	0.2766	0.2889	6.56e-10	8flj:H
7	4dky:B	101	89	0.3947	0.2970	0.3371	1.64e-09
8	1ihf:B	94	88	0.3026	0.2447	0.2614	1.15e-06	2ht0:B, 5j0n:J, 5j0n:L, 1ouz:B, 1owf:B, 1owg:B, 5wfe:L
9	2iie:A	204	63	0.2368	0.0882	0.2857	3.44e-04	2ht0:A, 1ihf:A, 2iif:A, 5j0n:I, 5j0n:K, 1ouz:A, 1owf:A, 1owg:A, 5wfe:K
10	2iie:A	204	59	0.2237	0.0833	0.2881	0.013	2ht0:A, 1ihf:A, 2iif:A, 5j0n:I, 5j0n:K, 1ouz:A, 1owf:A, 1owg:A, 5wfe:K
11	8flj:G	98	63	0.2105	0.1633	0.2540	0.002	8flj:E
12	2np2:A	102	93	0.2763	0.2059	0.2258	2.6	2np2:B
13	8i23:C	1164	26	0.1316	0.0086	0.3846	6.1	8i24:C

[Back]