MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKKGDALQLVGFGTFKVNHRAEANVPAFVSGKALKDAVK
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6oaj:B | 79 | 79 | 0.9595 | 0.8987 | 0.8987 | 1.32e-43 | 6o6k:A, 6o8q:A, 6o8q:I, 6oaj:C, 4yey:C, 4yf0:A, 4yfh:A |
2 | 4yew:C | 71 | 74 | 0.9324 | 0.9718 | 0.9324 | 1.10e-42 | 6o6k:B, 6oaj:D, 4yex:C, 4yft:C |
3 | 6o8q:B | 91 | 90 | 0.9730 | 0.7912 | 0.8000 | 2.04e-42 | 6o8q:G, 6o8q:H, 6o8q:F, 4yf0:B, 4yfh:B |
4 | 4qju:A | 90 | 90 | 0.5405 | 0.4444 | 0.4444 | 3.65e-19 | 4qju:B |
5 | 1p71:A | 94 | 89 | 0.4730 | 0.3723 | 0.3933 | 6.87e-14 | 1p51:A, 1p51:B, 1p51:D, 1p51:C, 1p71:B, 1p78:A, 1p78:B |
6 | 4dky:B | 101 | 89 | 0.4054 | 0.2970 | 0.3371 | 2.43e-09 | |
7 | 8flj:F | 94 | 90 | 0.3378 | 0.2660 | 0.2778 | 4.07e-08 | 8flj:H |
8 | 1ihf:B | 94 | 88 | 0.2973 | 0.2340 | 0.2500 | 2.78e-05 | 2ht0:B, 5j0n:J, 5j0n:L, 1ouz:B, 1owf:B, 1owg:B, 5wfe:L |
9 | 2iie:A | 204 | 62 | 0.2568 | 0.0931 | 0.3065 | 0.009 | 2ht0:A, 1ihf:A, 2iif:A, 5j0n:I, 5j0n:K, 1ouz:A, 1owf:A, 1owg:A, 5wfe:K |
10 | 2iie:A | 204 | 59 | 0.2162 | 0.0784 | 0.2712 | 0.23 | 2ht0:A, 1ihf:A, 2iif:A, 5j0n:I, 5j0n:K, 1ouz:A, 1owf:A, 1owg:A, 5wfe:K |
11 | 8flj:G | 98 | 50 | 0.1892 | 0.1429 | 0.2800 | 0.074 | 8flj:E |
12 | 5uwc:G | 253 | 35 | 0.1757 | 0.0514 | 0.3714 | 1.8 | |
13 | 2np2:A | 102 | 93 | 0.2703 | 0.1961 | 0.2151 | 5.0 | 2np2:B |