MNKKFTDEQQQQLIGHLTKKGFYRGANIKITIFLCGGDVANHQSWRHQLSQFLAKFSDVDIFYPEDLFDDLLAGQGQHSL
LSLENILAEAVDVIILFPESPGSFTELGAFSNNENLRRKLICIQDAKFKSKRSFINYGPVRLLRKFNSKSVLRCSSNELK
EMCDSSIDVARKLRLYKKLMASIKKVRKENKVSKDIGNILYAERFLLPCIYLLDSVNYRTLCELAFKAIKQDDVLSKIIV
RSVVSRLINERKILQMTDGYQVTALGASYVRSVFDRKTLDRLRLEIMNFENRRKSTFNYDKIPYAH
The query sequence (length=306) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xjg:J | 306 | 306 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8qbk:E, 8qbk:T, 8qbl:E, 8qbl:F, 8qbl:H, 8qbl:T, 8qbm:E, 8qbm:T, 8qbm:F, 8qbm:H |
2 | 8qbk:G | 133 | 110 | 0.3595 | 0.8271 | 1.0000 | 1.34e-74 | 8qbk:F, 8qbl:G, 8qbm:G, 7v9x:C, 7xjg:C |
3 | 8qbk:G | 133 | 23 | 0.0752 | 0.1729 | 1.0000 | 7.91e-09 | 8qbk:F, 8qbl:G, 8qbm:G, 7v9x:C, 7xjg:C |
4 | 8bja:A | 1563 | 58 | 0.0719 | 0.0141 | 0.3793 | 3.6 | |
5 | 3irm:A | 520 | 58 | 0.0621 | 0.0365 | 0.3276 | 6.2 | 3cl9:A, 3clb:A, 3clb:B, 3clb:C, 3clb:D, 2h2q:A, 2h2q:B, 3hbb:A, 3hbb:B, 3hbb:C, 3hbb:D, 3inv:A, 3inv:B, 3irm:B, 3irm:C, 3irm:D, 3irn:A, 3irn:B, 3irn:C, 3irn:D, 3iro:A, 3iro:B, 3iro:C, 3iro:D, 3kjs:A, 3kjs:B, 3kjs:C, 3kjs:D, 5t7o:A, 5t7o:B, 5t7o:C, 5t7o:D |