MNELVFIDDFDNHVVIMSEVVMRLNSYRQTHYTSTESGGTLIGERRGQHLVITHISEPGQDDVRNRTGLERKGIHHQQKV
NDLFQQSNGFIVYLGEWHTHPEDFPHPSFIDIKSWVMGIVATEPMIMLIVGRKDIWIGKKIKNDIKKLKKKM
The query sequence (length=152) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 9ild:A | 152 | 152 | 1.0000 | 1.0000 | 1.0000 | 1.08e-111 | |
2 | 6nu8:A | 488 | 42 | 0.0855 | 0.0266 | 0.3095 | 0.11 | |
3 | 8tpu:S8 | 317 | 59 | 0.1053 | 0.0505 | 0.2712 | 0.42 | |
4 | 1e7d:A | 157 | 97 | 0.1513 | 0.1465 | 0.2371 | 1.9 | 1e7d:B, 1e7l:A, 1e7l:B, 1en7:A, 1en7:B, 2qnc:A, 2qnc:B, 2qnf:A, 2qnf:B |
5 | 8oz7:A | 597 | 32 | 0.0526 | 0.0134 | 0.2500 | 5.2 | 8oz7:B, 8oz7:C, 8oz7:D |
6 | 2fk6:A | 307 | 57 | 0.0987 | 0.0489 | 0.2632 | 5.7 | 4gcw:A |
7 | 1y44:A | 269 | 33 | 0.0724 | 0.0409 | 0.3333 | 6.5 | |
8 | 1yge:A | 839 | 37 | 0.0987 | 0.0179 | 0.4054 | 8.1 | 3bnb:A, 3bnc:A, 3bnd:A, 3bne:A, 5eeo:A, 1f8n:A, 1fgm:A, 1fgo:A, 1fgq:A, 1fgr:A, 1fgt:A, 3pzw:A, 2sbl:B, 2sbl:A, 7soi:A, 7soi:B, 7soj:A, 7soj:B, 5t5v:A, 5t5v:B, 5tqn:A, 5tqn:B, 5tqo:A, 5tqo:B, 5tqp:A, 5tqp:B, 5tr0:A, 5tr0:B, 4wfo:A, 4wha:A, 1y4k:A |
9 | 4cot:A | 443 | 88 | 0.1382 | 0.0474 | 0.2386 | 8.7 | 2x8s:A, 2x8s:B |