MNEKSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRDRTNELKSKTDWHRIVVYDQNIVDLIDKYLRKGRRVYV
QGSLHTRKWHTNDQPKQITEIILSYNKGDLIFLD
The query sequence (length=114) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ulp:C | 116 | 116 | 0.9912 | 0.9741 | 0.9741 | 5.08e-78 | 3ulp:A, 3ulp:B, 3ulp:D |
2 | 1eqq:B | 120 | 102 | 0.3509 | 0.3333 | 0.3922 | 7.67e-26 | 1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D |
3 | 6rup:A | 111 | 113 | 0.3772 | 0.3874 | 0.3805 | 1.05e-22 | 6rup:B, 8uzt:A, 8uzt:C, 8uzt:D |
4 | 6irq:C | 104 | 110 | 0.3596 | 0.3942 | 0.3727 | 1.93e-22 | 6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D |
5 | 8uzt:B | 100 | 82 | 0.3070 | 0.3500 | 0.4268 | 8.24e-20 | |
6 | 5odp:G | 100 | 83 | 0.2544 | 0.2900 | 0.3494 | 1.07e-14 | 5odp:A |
7 | 5odn:D | 106 | 90 | 0.2719 | 0.2925 | 0.3444 | 2.24e-14 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
8 | 7dep:B | 102 | 85 | 0.2281 | 0.2549 | 0.3059 | 2.16e-08 | |
9 | 8gw5:A | 99 | 98 | 0.2456 | 0.2828 | 0.2857 | 7.00e-08 | 7ym1:A |
10 | 3vdy:A | 101 | 97 | 0.2281 | 0.2574 | 0.2680 | 1.35e-07 | 3vdy:B |
11 | 6bhx:C | 102 | 93 | 0.2456 | 0.2745 | 0.3011 | 1.47e-07 | 6bhx:A, 6bhx:B |
12 | 2vw9:A | 108 | 84 | 0.1842 | 0.1944 | 0.2500 | 1.74e-05 | 2vw9:B |
13 | 3udg:C | 214 | 84 | 0.2193 | 0.1168 | 0.2976 | 7.50e-04 | 3udg:B, 3udg:A |
14 | 3udg:C | 214 | 94 | 0.1842 | 0.0981 | 0.2234 | 0.009 | 3udg:B, 3udg:A |
15 | 6s48:A | 235 | 40 | 0.1140 | 0.0553 | 0.3250 | 0.19 | 6g3b:A, 6g3b:B, 6s48:B, 6s58:D |
16 | 6rm3:SD0 | 210 | 52 | 0.1404 | 0.0762 | 0.3077 | 2.6 | |
17 | 6bwy:B | 346 | 29 | 0.0877 | 0.0289 | 0.3448 | 3.0 | 6bwy:A, 6bwy:G, 6bwy:E, 1qzg:A, 1qzg:B, 1qzh:A, 1qzh:B, 1qzh:F, 1qzh:C, 1qzh:D, 1qzh:E |
18 | 1f9w:A | 300 | 62 | 0.1667 | 0.0633 | 0.3065 | 3.2 | 1f9w:B |
19 | 6k0b:C | 231 | 54 | 0.1579 | 0.0779 | 0.3333 | 3.7 | 6k0a:D, 6k0b:D |
20 | 4etp:A | 379 | 65 | 0.1667 | 0.0501 | 0.2923 | 3.8 | 1f9t:A, 1f9u:A, 1f9v:A, 3kar:A |
21 | 9c9y:A | 612 | 71 | 0.1404 | 0.0261 | 0.2254 | 4.7 | 9ca0:A, 9ca1:A |
22 | 7cuh:A | 305 | 50 | 0.1316 | 0.0492 | 0.3000 | 8.6 | 4hid:A, 4hik:A, 4him:A, 4hio:A, 4hj5:A, 4hj7:A, 4hj8:A, 4hj9:A, 4hja:A, 5usb:A, 5usn:A, 5uso:A |
23 | 8xku:B | 845 | 56 | 0.1491 | 0.0201 | 0.3036 | 8.9 | 8xkv:B |