MNEKSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRDRNTNELKSKTDWHRIVVYDQNIVDLIDKYLRKGRRVY
VQGSLHTRKWHTSQPKQITEIILSYNKGDLIFLD
The query sequence (length=114) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ulp:C | 116 | 116 | 1.0000 | 0.9828 | 0.9828 | 2.22e-80 | 3ulp:A, 3ulp:B, 3ulp:D |
2 | 1eqq:B | 120 | 102 | 0.3509 | 0.3333 | 0.3922 | 5.21e-28 | 1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D |
3 | 6irq:C | 104 | 110 | 0.3596 | 0.3942 | 0.3727 | 7.44e-24 | 6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D |
4 | 6rup:A | 111 | 83 | 0.3070 | 0.3153 | 0.4217 | 3.96e-20 | 6rup:B, 8uzt:A, 8uzt:C, 8uzt:D |
5 | 8uzt:B | 100 | 112 | 0.3684 | 0.4200 | 0.3750 | 9.09e-20 | |
6 | 5odp:G | 100 | 84 | 0.2719 | 0.3100 | 0.3690 | 4.48e-16 | 5odp:A |
7 | 5odn:D | 106 | 88 | 0.2632 | 0.2830 | 0.3409 | 7.36e-14 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
8 | 8gw5:A | 99 | 99 | 0.2456 | 0.2828 | 0.2828 | 2.08e-08 | 7ym1:A |
9 | 6bhx:C | 102 | 93 | 0.2368 | 0.2647 | 0.2903 | 2.91e-08 | 6bhx:A, 6bhx:B |
10 | 7dep:B | 102 | 86 | 0.2193 | 0.2451 | 0.2907 | 1.41e-07 | |
11 | 3vdy:A | 101 | 97 | 0.2193 | 0.2475 | 0.2577 | 4.37e-05 | 3vdy:B |
12 | 2vw9:A | 108 | 89 | 0.1930 | 0.2037 | 0.2472 | 2.09e-04 | 2vw9:B |
13 | 3udg:C | 214 | 84 | 0.2193 | 0.1168 | 0.2976 | 0.001 | 3udg:B, 3udg:A |
14 | 3udg:C | 214 | 93 | 0.1930 | 0.1028 | 0.2366 | 0.018 | 3udg:B, 3udg:A |
15 | 3a5u:A | 118 | 83 | 0.1842 | 0.1780 | 0.2530 | 0.005 | 3a5u:B |
16 | 8ovj:SU | 158 | 91 | 0.2193 | 0.1582 | 0.2747 | 1.2 | 8a3w:SU, 8a98:SU, 6az1:U, 8rxh:SU, 8rxx:SU, 5t2a:AE |
17 | 6s48:A | 235 | 29 | 0.0965 | 0.0468 | 0.3793 | 1.4 | 6g3b:A, 6g3b:B, 6s48:B, 6s58:D |
18 | 1je5:B | 182 | 77 | 0.1842 | 0.1154 | 0.2727 | 1.7 | |
19 | 6c25:A | 394 | 45 | 0.1579 | 0.0457 | 0.4000 | 1.8 | |
20 | 3o9z:A | 310 | 57 | 0.1579 | 0.0581 | 0.3158 | 2.1 | 3o9z:B, 3o9z:C, 3o9z:D, 3oa0:A, 3oa0:B, 3oa0:C, 3oa0:D |
21 | 8xku:B | 845 | 55 | 0.1579 | 0.0213 | 0.3273 | 2.3 | 8xkv:B |
22 | 8r5o:E | 912 | 51 | 0.1053 | 0.0132 | 0.2353 | 3.0 | 8ras:E |
23 | 1f9w:A | 300 | 66 | 0.1667 | 0.0633 | 0.2879 | 4.6 | 1f9w:B |
24 | 4etp:A | 379 | 66 | 0.1667 | 0.0501 | 0.2879 | 5.1 | 1f9t:A, 1f9u:A, 1f9v:A, 3kar:A |
25 | 1g5c:A | 169 | 43 | 0.1140 | 0.0769 | 0.3023 | 7.5 | 1g5c:B, 1g5c:C, 1g5c:D, 1g5c:E, 1g5c:F |