MNEKSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRDRNTNELKSKTDWHRIVVYDQNIVDLIDKYLRKGRRVY
VQGSLHTRKWHTNNSQPKQITEIILSYNKGDLIFLD
The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ulp:C | 116 | 116 | 1.0000 | 1.0000 | 1.0000 | 8.71e-84 | 3ulp:A, 3ulp:B, 3ulp:D |
2 | 1eqq:B | 120 | 102 | 0.3448 | 0.3333 | 0.3922 | 2.92e-29 | 1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D |
3 | 6rup:A | 111 | 114 | 0.3707 | 0.3874 | 0.3772 | 2.62e-22 | 6rup:B, 8uzt:A, 8uzt:C, 8uzt:D |
4 | 6irq:C | 104 | 112 | 0.3534 | 0.3942 | 0.3661 | 5.18e-22 | 6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D |
5 | 8uzt:B | 100 | 83 | 0.3017 | 0.3500 | 0.4217 | 1.20e-19 | |
6 | 5odp:G | 100 | 84 | 0.2672 | 0.3100 | 0.3690 | 5.57e-16 | 5odp:A |
7 | 5odn:D | 106 | 100 | 0.2759 | 0.3019 | 0.3200 | 5.44e-15 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
8 | 6bhx:C | 102 | 98 | 0.2500 | 0.2843 | 0.2959 | 8.76e-09 | 6bhx:A, 6bhx:B |
9 | 8gw5:A | 99 | 99 | 0.2414 | 0.2828 | 0.2828 | 1.45e-08 | 7ym1:A |
10 | 7dep:B | 102 | 86 | 0.2155 | 0.2451 | 0.2907 | 2.11e-07 | |
11 | 3vdy:A | 101 | 88 | 0.2069 | 0.2376 | 0.2727 | 1.21e-05 | 3vdy:B |
12 | 2vw9:A | 108 | 89 | 0.1897 | 0.2037 | 0.2472 | 2.24e-04 | 2vw9:B |
13 | 3udg:C | 214 | 84 | 0.2155 | 0.1168 | 0.2976 | 0.001 | 3udg:B, 3udg:A |
14 | 3udg:C | 214 | 91 | 0.1897 | 0.1028 | 0.2418 | 0.033 | 3udg:B, 3udg:A |
15 | 3a5u:A | 118 | 96 | 0.1983 | 0.1949 | 0.2396 | 0.002 | 3a5u:B |
16 | 6s48:A | 235 | 29 | 0.0948 | 0.0468 | 0.3793 | 1.4 | 6g3b:A, 6g3b:B, 6s48:B, 6s58:D |
17 | 6c25:A | 394 | 45 | 0.1552 | 0.0457 | 0.4000 | 1.7 | |
18 | 8r5o:E | 912 | 51 | 0.1034 | 0.0132 | 0.2353 | 3.2 | 8ras:E |
19 | 1je5:B | 182 | 76 | 0.1810 | 0.1154 | 0.2763 | 3.2 | |
20 | 1iru:D | 243 | 62 | 0.1293 | 0.0617 | 0.2419 | 3.6 | 8bzl:Q, 8bzl:C, 1iru:R |
21 | 8ovj:SU | 158 | 66 | 0.1638 | 0.1203 | 0.2879 | 5.1 | 8a3w:SU, 8a98:SU, 6az1:U, 8rxh:SU, 8rxx:SU, 5t2a:AE |
22 | 1f9w:A | 300 | 66 | 0.1638 | 0.0633 | 0.2879 | 5.4 | 1f9w:B |
23 | 4etp:A | 379 | 66 | 0.1638 | 0.0501 | 0.2879 | 5.8 | 1f9t:A, 1f9u:A, 1f9v:A, 3kar:A |
24 | 6g21:A | 504 | 64 | 0.1207 | 0.0278 | 0.2188 | 6.5 | 6g21:B |
25 | 1g5c:A | 169 | 43 | 0.1121 | 0.0769 | 0.3023 | 7.2 | 1g5c:B, 1g5c:C, 1g5c:D, 1g5c:E, 1g5c:F |
26 | 4yds:A | 226 | 54 | 0.1293 | 0.0664 | 0.2778 | 7.8 |