BioLiP

>protein
MNEKSLNKIMLIGRVGCEPDIKILNGGDKVATFSLATNEFWRDRNELKSKTDWHRIVVYDQNIVDLIDKYLRKGRRVYVQ
GSLHTRKWHTNSQPKQITEIILSYNKGDLIFLD

The query sequence (length=113) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ulp:C	116	116	1.0000	0.9741	0.9741	1.04e-77	3ulp:A, 3ulp:B, 3ulp:D
2	1eqq:B	120	102	0.3540	0.3333	0.3922	2.51e-25	1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D
3	6irq:C	104	109	0.3717	0.4038	0.3853	7.16e-23	6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D
4	6rup:A	111	113	0.3805	0.3874	0.3805	6.86e-21	6rup:B, 8uzt:A, 8uzt:C, 8uzt:D
5	8uzt:B	100	111	0.3717	0.4200	0.3784	6.13e-20
6	5odp:G	100	84	0.2743	0.3100	0.3690	2.83e-14	5odp:A
7	5odn:D	106	86	0.2655	0.2830	0.3488	3.42e-14	5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H
8	6bhx:C	102	92	0.2566	0.2843	0.3152	2.17e-08	6bhx:A, 6bhx:B
9	7dep:B	102	84	0.2212	0.2451	0.2976	7.24e-08
10	8gw5:A	99	98	0.2566	0.2929	0.2959	8.08e-08	7ym1:A
11	3vdy:A	101	96	0.2212	0.2475	0.2604	6.99e-06	3vdy:B
12	2vw9:A	108	94	0.2035	0.2130	0.2447	1.01e-04	2vw9:B
13	3udg:C	214	81	0.2124	0.1121	0.2963	0.001	3udg:B, 3udg:A
14	3udg:C	214	95	0.2035	0.1075	0.2421	0.018	3udg:B, 3udg:A
15	3a5u:A	118	95	0.1947	0.1864	0.2316	0.011	3a5u:B
16	6rm3:SD0	210	52	0.1416	0.0762	0.3077	2.1
17	6s48:A	235	27	0.0973	0.0468	0.4074	2.3	6g3b:A, 6g3b:B, 6s48:B, 6s58:D
18	1f9w:A	300	62	0.1504	0.0567	0.2742	2.6	1f9w:B
19	4etp:A	379	62	0.1504	0.0449	0.2742	3.7	1f9t:A, 1f9u:A, 1f9v:A, 3kar:A
20	7pu7:A	1070	36	0.1150	0.0121	0.3611	3.9	5lew:A
21	4gkr:B	307	62	0.1504	0.0554	0.2742	4.4	4gkr:A
22	4kyr:A	208	57	0.1239	0.0673	0.2456	4.8
23	7mjr:A	899	79	0.1858	0.0234	0.2658	5.5

[Back]