BioLiP

>protein
MNDVNRIRTDIINVAKTFGAEYSEKVLDEVFQVFGEQFADNSFMIRTSNKQPDKLGCYFRYHEEDESQLGLAWDIARKSG
LLSDQGRPVDQLIPEICETFPIMADGVDFDVKHGLAKIWQSIKGVVPVQDAFKLSLPASVTTHSDFLKNHHLDALYAFGI
DYHHSSVNLYFDTYHPKHHTSEYYKNLLQDLQFQPPSDELLELLTNNGEIALTFNFASPRIERLCFYLPFLNREAVPQNL
LNPLLKKYINEAPALVDNPGFILGWSFGPQGGKGTYTKVDVDYHGRTVPL

The query sequence (length=290) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5z43:A	292	290	1.0000	0.9932	1.0000	0.0	5z43:B, 5z44:A, 5z44:B, 5z45:A, 5z45:B, 5z46:A, 5z46:B
2	5ynv:B	313	290	0.5966	0.5527	0.5966	9.16e-126	5y72:A, 5y72:B, 5y7c:A, 5y7c:B, 5y84:A, 5y84:B, 5ynt:A, 5ynt:B, 5ynu:A, 5ynu:B, 5ynv:A, 5ynw:A, 5ynw:B
3	2xlq:A	316	303	0.2828	0.2595	0.2706	7.46e-22	2xm7:A
4	4ee7:A	290	280	0.2552	0.2552	0.2643	2.53e-19
5	7fhb:A	306	216	0.1828	0.1732	0.2454	1.74e-10	1zb6:A, 1zcw:A, 1zdw:A, 1zdy:A
6	3bry:A	389	100	0.0862	0.0643	0.2500	0.68	3bry:B
7	6gn6:F	428	61	0.0759	0.0514	0.3607	2.9	6gn6:A, 6gn6:C, 6gn6:E, 6gn6:D, 6gn6:B
8	2fco:A	154	36	0.0379	0.0714	0.3056	3.9	2fco:B
9	7aqc:R	558	58	0.0586	0.0305	0.2931	4.9	7aqd:R, 7as8:0, 7as9:0, 7asa:0, 7ope:0
10	8d1x:D	469	39	0.0414	0.0256	0.3077	5.1	8d1x:A, 8d1x:B, 8d1x:C, 8d1x:E, 8d1x:F
11	7dva:A	523	28	0.0379	0.0210	0.3929	5.1	7dva:B, 7dvb:A, 7dvb:B, 7dvb:C, 7dvb:D
12	5a7i:A	313	142	0.1103	0.1022	0.2254	7.5	5a7j:A, 5a7j:B, 4cml:A, 3mtc:A, 3n9v:A, 3n9v:B
13	7c4k:A	614	35	0.0483	0.0228	0.4000	7.7	7c4l:A, 7c4m:A, 7c4n:A
14	8pe3:A	386	43	0.0552	0.0415	0.3721	8.3	8pe3:B
15	7ns9:A	178	40	0.0483	0.0787	0.3500	8.9	7nsa:A, 7nsd:A, 7nsf:A, 7oa2:A

[Back]