BioLiP

>protein
MMYVKLISSDGHEFIVKREHALTSGTIKAMLTNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLM
AANFLDC

The query sequence (length=87) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6gmn:K	87	87	1.0000	1.0000	1.0000	1.37e-61	3dcg:D, 3dcg:B, 6gmx:K
2	2jz3:C	96	96	0.9885	0.8958	0.8958	1.80e-57	9bju:K, 6gmn:B, 6gmx:B
3	1hv2:A	99	93	0.3908	0.3434	0.3656	2.34e-15
4	8zuh:B	137	86	0.3563	0.2263	0.3605	1.82e-04
5	2vd8:A	387	35	0.1609	0.0362	0.4000	2.9	2vd8:B, 2vd9:A, 2vd9:B
6	1j1t:A	228	86	0.2529	0.0965	0.2558	3.1	4q8k:A, 4q8l:A, 4q8l:B
7	6oh9:A	452	35	0.1609	0.0310	0.4000	5.8	6oha:A
8	8gm4:A	462	41	0.1149	0.0216	0.2439	8.4
9	8fny:A	497	41	0.1149	0.0201	0.2439	8.4	8fny:C, 8fo6:A, 8gm5:A, 7shq:A
10	6twi:E	323	36	0.1724	0.0464	0.4167	9.4	4cyw:A, 4cyw:C, 4cyw:E, 4cyz:A, 4cyz:E, 4cz0:A, 4cz0:E, 4cz0:C, 4d00:A, 4d00:C, 4d00:E, 4qy1:E, 4qy1:G, 4qy1:I, 4qy1:U, 4qy2:E, 5tgu:C, 5tgu:E, 5tgu:A, 5tgv:A, 5tgv:C, 5tgv:E, 5th1:A, 5th1:C, 5th1:E, 5thc:E, 5thc:C, 6tva:A, 6tva:C, 6tva:E, 6tvb:A, 6tvb:C, 6tvb:E, 6tvd:A, 6tvd:C, 6tvd:E, 6tvd:G, 6tvd:I, 6tvd:K, 6tvf:A, 6tvf:C, 6tvf:E, 6tvf:G, 6tvf:K, 6tvf:I, 6tvr:K, 6tvs:C, 6tvs:E, 6tvs:K, 6tvt:A, 6tvt:C, 6tvt:E, 6twi:A, 6twi:C, 6twv:C, 6twv:E, 6twv:K, 6twv:G, 6twv:I, 6txo:A, 6txo:C, 6txo:E, 6ty1:A, 6ty1:C, 6ty1:E, 6ty1:G, 6ty1:I, 6ty1:K, 4xqo:A, 4xqo:C, 4xqu:A, 4xqu:C, 4xqu:E
11	7dvq:Y	140	28	0.1379	0.0857	0.4286	9.6	8i0p:Y, 8i0r:Y

[Back]