MMYVKLISSDGHEFIVKREHALTSGTIKAMLNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMA
ANFLDC
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6gmn:K | 87 | 87 | 1.0000 | 0.9885 | 0.9885 | 5.13e-59 | 3dcg:D, 3dcg:B, 6gmx:K |
2 | 2jz3:C | 96 | 96 | 0.9884 | 0.8854 | 0.8854 | 1.65e-56 | 9bju:K, 6gmn:B, 6gmx:B |
3 | 1hv2:A | 99 | 93 | 0.3953 | 0.3434 | 0.3656 | 2.84e-15 | |
4 | 8zuh:B | 137 | 86 | 0.3605 | 0.2263 | 0.3605 | 3.22e-05 | |
5 | 6s87:D | 365 | 58 | 0.1860 | 0.0438 | 0.2759 | 2.8 | |
6 | 4v6w:AD | 227 | 50 | 0.2209 | 0.0837 | 0.3800 | 6.9 | 6xu6:AD, 6xu7:AD, 6xu8:AD |
7 | 1rj5:A | 259 | 45 | 0.1512 | 0.0502 | 0.2889 | 8.9 | 1rj5:B, 1rj6:A, 1rj6:B |
8 | 1j1t:A | 228 | 27 | 0.1279 | 0.0482 | 0.4074 | 9.9 | 4q8k:A, 4q8l:A, 4q8l:B |