MMRIVAADTGGAVLDETFEPIGLIATVAVLVEKPYRSAKEVMVKYANPYDYDLTGRQAIRDEVLLAIELARKVKPDVIHL
DSTLGGIELRKLDEPTIDALGISDKGKEVWKELSKDLQPLARKFWEETNIEIVAIGKSSVPVRIAEIYAGIYSAKWGIEN
VEKEGHLIIGLPRYMEVNIKDGKIIGRSLDPREGGLYGSAEVSVPEGVKWEIYPNPVARRFMIFEIFSKR
The query sequence (length=230) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5chi:A | 230 | 230 | 1.0000 | 1.0000 | 1.0000 | 2.61e-166 | 5chi:B, 5chi:C |
2 | 4yor:A | 227 | 227 | 0.7652 | 0.7753 | 0.7753 | 8.68e-133 | 4yor:B, 4yot:A, 4yot:B, 4yot:C, 4you:A, 4you:C, 4yov:A, 4yov:C, 4yov:E, 4yow:A, 4yow:C, 4yow:E, 4yox:A, 4yox:C, 4yox:E, 4yoy:A, 4yoy:C, 4yoy:E |
3 | 4you:B | 199 | 228 | 0.6783 | 0.7839 | 0.6842 | 1.40e-106 | |
4 | 1mpy:A | 307 | 82 | 0.0913 | 0.0684 | 0.2561 | 0.50 | 1mpy:B, 1mpy:C, 1mpy:D |
5 | 7tom:A | 498 | 47 | 0.0565 | 0.0261 | 0.2766 | 2.8 | 7tol:A |
6 | 3pps:A | 564 | 68 | 0.0913 | 0.0372 | 0.3088 | 4.1 | 3pps:B, 3pps:C, 3pps:D |
7 | 5msu:B | 459 | 50 | 0.0652 | 0.0327 | 0.3000 | 4.5 | 5mso:A, 5msu:C, 5msu:A |
8 | 2ixl:C | 197 | 46 | 0.0652 | 0.0761 | 0.3261 | 5.4 | 2ixl:A, 2ixl:B, 2ixl:D, 1nyw:A, 1nyw:B, 1nzc:A, 1nzc:B, 1nzc:C, 1nzc:D |