MMRCPECSTEGWRVLPLTVGAHVKEGLWSKIKGDFYFCSLESCEVVYFNEQTVFRKGELKTRVGVKEREEPKPVCYCNRV
TEKMLLEAAEKFGKEKAVEITGAGKGKWCVVTNPSGRCCHWHLERLGFPV
The query sequence (length=130) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2hu9:A | 130 | 130 | 1.0000 | 1.0000 | 1.0000 | 1.77e-93 | 2hu9:B |
2 | 7nkg:D | 565 | 39 | 0.1000 | 0.0230 | 0.3333 | 0.80 | 7nkg:A, 7nkg:G, 7nkg:J |
3 | 2jis:B | 487 | 72 | 0.1692 | 0.0452 | 0.3056 | 1.5 | 2jis:A, 6zek:A, 6zek:B, 6zek:C, 6zek:D |
4 | 5thy:A | 387 | 58 | 0.1308 | 0.0439 | 0.2931 | 2.9 | 5thy:B, 5thz:B, 5thz:A |
5 | 4ixm:A | 318 | 34 | 0.0923 | 0.0377 | 0.3529 | 5.8 | 4ixm:B, 4ixn:A, 4ixn:B |
6 | 1bdg:A | 444 | 45 | 0.1000 | 0.0293 | 0.2889 | 8.4 | |
7 | 8tl6:B | 353 | 49 | 0.1231 | 0.0453 | 0.3265 | 8.5 | |
8 | 2rt9:A | 52 | 52 | 0.1231 | 0.3077 | 0.3077 | 9.2 |