MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHRQLLFVTSFVFAGYFYLKRQN
YLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR
The query sequence (length=120) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8iaq:d | 120 | 120 | 1.0000 | 1.0000 | 1.0000 | 3.30e-86 | 8ib6:d, 8ibb:d, 8ibf:d, 8ic4:d |
| 2 | 7v2h:g | 122 | 120 | 0.7667 | 0.7541 | 0.7667 | 9.61e-68 | 5gup:g, 8ud1:1d, 8ugi:1d, 7v2c:g, 7v2d:g, 7v2e:g, 7v2f:g, 7v2k:g, 7v2r:g, 7v30:g, 7v31:g, 7v32:g, 7v33:g, 7v3m:g, 7vbl:g, 7vbp:g, 7vc0:g, 7vwl:g, 7vxs:g, 7vy1:g, 7vy9:g, 7vye:g, 7vyg:g, 7vyi:g, 7vys:g, 7vz8:g, 7vzv:g, 7vzw:g, 7w00:g, 7w0h:g, 7w0r:g, 7w0y:g, 7w1o:g, 7w1p:g, 7w1t:g, 7w1u:g, 7w1v:g, 7w1z:g, 7w20:g, 7w2k:g, 7w2l:g, 7w2r:g, 7w2u:g, 7w2y:g, 7w31:g, 7w32:g, 7w35:g, 7w4c:g, 7w4d:g, 7w4e:g, 7w4f:g, 7w4g:g, 7w4j:g, 7w4k:g, 7w4l:g, 7w4m:g, 7w4n:g, 7w4q:g |
| 3 | 5xtc:g | 119 | 119 | 0.6833 | 0.6891 | 0.6891 | 3.03e-61 | 5xtd:g, 5xth:g, 5xti:g, 5xti:Bg |
| 4 | 7r41:d | 113 | 110 | 0.6750 | 0.7168 | 0.7364 | 1.08e-60 | 7r42:d, 7r44:d, 7r45:d, 7r47:d, 7r48:d, 7r4c:d, 7r4d:d, 7r4f:d, 7r4g:d |
| 5 | 5fhd:B | 400 | 25 | 0.1083 | 0.0325 | 0.5200 | 9.2 |
umich.edu