MMIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEELIGRKVTFVQDNHSKSKKNVLRGLHFQRGENAQGKLVRCAVG
EVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHGFVTLSEYAEFLYKATNYYSPSSEGSILWNDEAIGIEWPF
SQLPELSAKDAAAPLLDQALLTE
The query sequence (length=183) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1dzt:A | 183 | 183 | 1.0000 | 1.0000 | 1.0000 | 9.68e-137 | 1dzt:B |
2 | 2ixh:A | 184 | 169 | 0.6066 | 0.6033 | 0.6568 | 4.74e-82 | 2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B |
3 | 6ndr:A | 188 | 176 | 0.5738 | 0.5585 | 0.5966 | 9.64e-72 | 6ndr:B |
4 | 6c46:A | 183 | 177 | 0.5301 | 0.5301 | 0.5480 | 6.94e-64 | 6c46:D |
5 | 7pvi:AAA | 199 | 175 | 0.5137 | 0.4724 | 0.5371 | 2.89e-60 | 7pvi:BBB, 7pwb:AAA, 7pwb:BBB |
6 | 1epz:A | 183 | 168 | 0.4918 | 0.4918 | 0.5357 | 8.51e-58 | |
7 | 3ryk:A | 175 | 176 | 0.4863 | 0.5086 | 0.5057 | 1.21e-57 | 3ryk:B |
8 | 2ixc:A | 198 | 168 | 0.3607 | 0.3333 | 0.3929 | 4.40e-40 | 2ixc:B, 2ixc:C, 2ixc:D |
9 | 5buv:A | 174 | 167 | 0.3279 | 0.3448 | 0.3593 | 9.51e-36 | 5buv:B |
10 | 7pwh:AAA | 203 | 159 | 0.3224 | 0.2906 | 0.3711 | 1.26e-29 | |
11 | 1oi6:A | 202 | 175 | 0.3169 | 0.2871 | 0.3314 | 5.77e-29 | 1oi6:B |
12 | 8dcl:A | 185 | 165 | 0.3005 | 0.2973 | 0.3333 | 1.17e-27 | 7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B |
13 | 4hn1:C | 201 | 164 | 0.2896 | 0.2637 | 0.3232 | 3.09e-26 | 4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D |
14 | 7m15:D | 181 | 165 | 0.3060 | 0.3094 | 0.3394 | 4.38e-25 | 7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F |
15 | 8dco:B | 181 | 165 | 0.2951 | 0.2983 | 0.3273 | 4.80e-24 | 8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A |
16 | 2ixl:C | 197 | 177 | 0.2951 | 0.2741 | 0.3051 | 7.87e-14 | 2ixl:A, 2ixl:B, 2ixl:D, 1nyw:A, 1nyw:B, 1nzc:A, 1nzc:B, 1nzc:C, 1nzc:D |
17 | 5x5t:A | 476 | 49 | 0.0874 | 0.0336 | 0.3265 | 6.5 | 5x5t:B, 5x5u:A, 5x5u:B |
18 | 8ptk:f | 4502 | 50 | 0.0820 | 0.0033 | 0.3000 | 7.1 | 8ptk:e |
19 | 7z8f:e | 4579 | 50 | 0.0820 | 0.0033 | 0.3000 | 7.4 | 5owo:A, 8pr2:f, 8ptk:m, 8ptk:n, 7z8f:f, 7z8f:m, 7z8f:n, 7z8h:A |
20 | 8pyh:B | 319 | 35 | 0.0820 | 0.0470 | 0.4286 | 8.0 | 8pyh:A |
21 | 5ltm:B | 537 | 60 | 0.0984 | 0.0335 | 0.3000 | 8.1 | 5ltm:A |
22 | 8a1y:F | 408 | 61 | 0.0874 | 0.0392 | 0.2623 | 8.7 | 8a1t:F, 8a1u:F, 8a1v:F, 8a1w:F, 8a1x:F, 8acw:F, 8acy:F, 8ad0:F, 8ad3:A, 8ad3:B, 8ad4:A, 8ad4:B, 8ad5:A, 8ad5:B, 4u9u:A, 4u9u:B, 4uaj:A, 7xk3:F, 7xk4:F, 7xk5:F, 7xk6:F, 7xk7:F |
23 | 7dhe:B | 147 | 46 | 0.0765 | 0.0952 | 0.3043 | 10.0 | 7dhe:A, 7dhe:C, 7dhe:D |