BioLiP

>protein
MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQLLPGTQGLYGFVIAFLIFINL
GSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQILAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA

The query sequence (length=156) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3aou:A	156	156	1.0000	1.0000	1.0000	4.93e-106	3aou:B, 3aou:C, 3aou:D, 3aou:E, 3aou:F, 3aou:G, 3aou:H, 3aou:I, 3aou:J, 2bl2:A, 2bl2:B, 2bl2:C, 2bl2:D, 2bl2:E, 2bl2:F, 2bl2:G, 2bl2:H, 2bl2:I, 2bl2:J, 2db4:A, 2db4:B, 2db4:C, 2db4:D, 2db4:E, 2db4:F, 2db4:G, 2db4:H, 2db4:I, 2db4:J
2	7khr:o	151	139	0.2692	0.2781	0.3022	7.65e-14	9b8o:h, 9b8o:i, 9b8o:j, 9b8o:k, 9b8o:l, 9b8o:n, 9b8o:m, 9b8o:o, 9brd:h, 9brd:i, 9brd:j, 9brd:k, 9brd:m, 9brd:l, 9brd:n, 9brd:o, 7khr:c, 7khr:k, 7khr:l, 7khr:m, 7khr:p, 6wlw:7, 6wlw:3, 6wlw:4, 6wm2:3
3	7tao:E	159	139	0.2372	0.2327	0.2662	5.63e-11	7tao:F, 7tao:G, 7tao:H, 7tao:I, 7tao:J, 7tao:K, 7tao:L, 7tap:E, 7tap:F, 7tap:G, 7tap:H, 7tap:I, 7tap:J, 7tap:K
4	7tao:D	158	141	0.2500	0.2468	0.2766	2.08e-08	7tap:D
5	6wlw:0	204	159	0.2051	0.1569	0.2013	0.74	6wm2:0
6	2gcg:A	324	88	0.1474	0.0710	0.2614	5.6	2gcg:B, 2gcg:C, 2gcg:D
7	7mtq:B	744	20	0.0705	0.0148	0.5500	8.1	8jd4:2
8	8eyk:E	966	40	0.1026	0.0166	0.4000	9.4	8eyi:E, 8gkc:A, 8gkc:D
9	7wew:A	481	46	0.1026	0.0333	0.3478	9.5
10	4lma:A	318	31	0.0962	0.0472	0.4839	9.7	4lma:B

[Back]