MLYNVALIKFKDIADKRGHLTPIEGKIDIPFDIKRVYYITKVDKDITRGYHSHKKLHQVLICLNGSVKIRLKIPDEEKII
ELNDPSVGLYIGPLVWHEMFDFTEGCVLLVLASEYYDETDYIRNYDFYIDEAKKRF
The query sequence (length=136) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4o9g:A | 138 | 136 | 0.9779 | 0.9638 | 0.9779 | 1.53e-94 | 4o9e:A, 4o9e:B, 4o9g:B, 4zu5:B, 4zu7:A, 4zu7:B, 4zu7:C, 4zu7:D, 4zu7:E, 4zu7:F, 4zu7:G, 4zu7:H |
2 | 2pae:A | 136 | 122 | 0.5000 | 0.5000 | 0.5574 | 5.73e-45 | 2pa7:A, 2pa7:B, 2pae:B, 2pak:A, 2pak:B, 2pam:A, 2pam:B |
3 | 5tpu:A | 133 | 129 | 0.4412 | 0.4511 | 0.4651 | 3.16e-36 | 5tpu:B, 5tpu:C, 5tpu:D |
4 | 7n67:B | 133 | 123 | 0.4191 | 0.4286 | 0.4634 | 1.52e-34 | 7n67:A |
5 | 5tpv:B | 138 | 127 | 0.3382 | 0.3333 | 0.3622 | 8.50e-26 | 5tpv:A, 5tpv:C |
6 | 4mzu:F | 294 | 124 | 0.3309 | 0.1531 | 0.3629 | 7.53e-21 | 4mzu:A, 4mzu:C, 4mzu:E, 4mzu:B, 4mzu:D, 4mzu:G, 4mzu:I, 4mzu:K, 4mzu:H, 4mzu:J, 4mzu:L, 4zu4:A, 4zu4:B, 4zu4:C |
7 | 8w9z:G | 218 | 93 | 0.1691 | 0.1055 | 0.2473 | 0.64 | 8wa0:G, 8wa1:G |
8 | 7pwh:AAA | 203 | 125 | 0.1985 | 0.1330 | 0.2160 | 1.3 | |
9 | 7e1v:A | 378 | 90 | 0.1618 | 0.0582 | 0.2444 | 9.8 | 7e1v:M, 7e1w:M, 7e1w:A, 7e1x:M, 7e1x:A, 8hcr:A, 8hcr:M |