MLVINGTPRKHGRTRIAASYIAALYHTDLIDLSEFVLPVFNGEAEQSELLKVQELKQRVTKADAIVLLSPEYHSGMSGAL
KNALDFLSSEQFKYKPVALLAVAGGGDGGINALNNMRTVMRGVYANVIPKQLVLKPVHIDVENATVAENIKESIKELVEE
LSMFAK
The query sequence (length=166) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3gfr:D | 172 | 166 | 0.9880 | 0.9535 | 0.9880 | 3.63e-118 | 3gfq:A, 3gfq:B, 3gfq:C, 3gfq:D, 3gfr:A, 3gfr:B, 3gfr:C, 3gfs:A, 3gfs:B, 3gfs:C, 3gfs:D, 3gfs:E, 3gfs:F, 3gfs:G, 3gfs:H, 3gfs:I, 3gfs:J, 3gfs:K, 3gfs:L, 2gsw:A, 2gsw:B, 2gsw:C, 2gsw:D, 1nni:1 |
2 | 7bx9:A | 168 | 165 | 0.6867 | 0.6786 | 0.6909 | 2.68e-75 | |
3 | 7f76:B | 173 | 166 | 0.6205 | 0.5954 | 0.6205 | 6.49e-71 | 7f76:A |
4 | 4h6p:A | 184 | 69 | 0.1627 | 0.1467 | 0.3913 | 3.24e-09 | 4h6p:B, 4h6p:C, 4h6p:D, 4h6p:E, 4h6p:F, 4h6p:G, 4h6p:L, 4h6p:H, 4h6p:I, 4h6p:J, 4h6p:K, 4hs4:B, 4hs4:C, 4hs4:D, 4hs4:G, 4hs4:H, 3s2y:A, 3s2y:B, 3s2y:C, 3s2y:D |
5 | 1t0i:A | 185 | 110 | 0.2108 | 0.1892 | 0.3182 | 3.78e-09 | 1t0i:B |
6 | 3svl:B | 182 | 136 | 0.2108 | 0.1923 | 0.2574 | 1.93e-08 | 3svl:A |
7 | 1x77:A | 174 | 81 | 0.1627 | 0.1552 | 0.3333 | 2.44e-08 | 1x77:B |
8 | 3u7r:A | 182 | 73 | 0.1325 | 0.1209 | 0.3014 | 3.97e-06 | 3u7r:B |
9 | 4f8y:A | 196 | 108 | 0.1988 | 0.1684 | 0.3056 | 2.66e-05 | 4f8y:B, 4f8y:C, 4f8y:D, 3lcm:A, 3lcm:B, 3lcm:C, 3lcm:D |
10 | 4pty:A | 174 | 53 | 0.1024 | 0.0977 | 0.3208 | 0.016 | 6dqo:A, 4pty:B, 4ptz:C, 4ptz:A, 4ptz:B, 4ptz:D, 4pu0:C, 4pu0:A, 4pu0:D |
11 | 8ok9:A | 430 | 67 | 0.1145 | 0.0442 | 0.2836 | 1.3 | 2bgg:A, 8pvv:A, 8qg0:A, 6t5t:A, 6tuo:A, 2w42:A, 6xu0:A, 6xu0:B, 6xup:A, 6xup:B, 1ytu:A, 1ytu:B |
12 | 7x5j:C | 256 | 80 | 0.1506 | 0.0977 | 0.3125 | 1.4 | 7x5j:D, 7x5j:A, 7x5j:E, 7x5j:B, 7x5j:F |
13 | 1rxv:A | 305 | 64 | 0.0964 | 0.0525 | 0.2500 | 1.5 | 1rxv:B, 1rxw:A |
14 | 2bgg:B | 394 | 67 | 0.1145 | 0.0482 | 0.2836 | 1.5 | 2w42:B |
15 | 7n2x:A | 201 | 80 | 0.1325 | 0.1095 | 0.2750 | 2.3 | 2d5i:A, 1v4b:A, 2z98:A, 2z9b:A, 2z9c:A, 2z9d:A, 2z9d:B |
16 | 1t5b:A | 199 | 77 | 0.1145 | 0.0955 | 0.2468 | 3.1 | 1t5b:B |
17 | 7awv:A | 210 | 53 | 0.1084 | 0.0857 | 0.3396 | 5.1 | 7awv:B |
18 | 5n4b:A | 722 | 66 | 0.1024 | 0.0235 | 0.2576 | 5.3 | 5n4b:B, 5n4d:A, 5n4d:B |
19 | 4ese:A | 193 | 80 | 0.1265 | 0.1088 | 0.2625 | 8.6 | |
20 | 9exw:A | 148 | 92 | 0.1566 | 0.1757 | 0.2826 | 9.9 | 9exw:B, 9exx:A, 9exx:B, 9exy:A, 7lmt:A, 7lmt:H, 7lmt:B, 7lmt:C, 7lmt:D, 7lmt:E, 7lmt:F, 7lmt:G, 7mdn:A, 7mdn:H, 7mdn:B, 7mdn:C, 7mdn:D, 7mdn:E, 7mdn:F, 7mdn:G, 6ue6:A, 6ue6:B, 6ue6:D, 6ue6:E, 6ue6:G, 6ue6:H, 5vc8:A, 7vln:B, 6xcg:A, 6xcg:B, 6xcg:C |