BioLiP

>protein
MLVDLNVPWPQNSYADKVTSQAVNNLIKTLSTLHMLGYTHIAINFTVNHSEKFPNDVKLLNPIDIKRRFGELMDRTGLKL
YSRITLIIDDPSKGQSLSKISQAFDIVAALPISEKGLTLSTTNLDIDLLTFQYGSRLPTFLKHKSICSCVNRGVKLEIVY
GYALRDVQARRQFVSNVRSVIRSSRSRGIVIGSGAMSPLECRNILGVTSLIKNLGLPSDRCSKAMGDLASLVLLNGRLRN
KSHKQTIVTGGGSGNGDDVVNDVQGIDDVQTIKVVKRSMDAEQLGHASKRHKP

The query sequence (length=293) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6agb:J	293	293	1.0000	1.0000	1.0000	0.0	6agb:I, 6ah3:I, 6ah3:J, 7c79:I, 7c79:J, 7c7a:I, 7c7a:J, 6w6v:I, 6w6v:J
2	6ahr:J	247	229	0.2253	0.2672	0.2882	4.08e-25	6ahr:I, 6ahu:I, 6ahu:J
3	5d6a:A	548	63	0.0751	0.0401	0.3492	0.14
4	8tj8:A	317	43	0.0444	0.0410	0.3023	0.80
5	1b33:A	160	49	0.0648	0.1187	0.3878	1.3	6yx7:KKK, 6yx8:AAA, 6yx8:CCC, 6yx8:EEE
6	6gwj:K	334	61	0.0580	0.0509	0.2787	1.3
7	8jzd:A	166	90	0.0819	0.1446	0.2667	1.4	8jzd:C
8	2a1u:B	252	110	0.0956	0.1111	0.2545	2.2	2a1t:S, 1efv:B, 1t9g:S
9	8k20:A	337	61	0.0546	0.0475	0.2623	2.5
10	2c2g:A	448	47	0.0580	0.0379	0.3617	3.6	2c2b:A, 2c2b:B, 2c2b:C, 2c2b:D, 2c2b:E, 2c2b:F, 2c2g:B
11	7dsk:B	464	39	0.0614	0.0388	0.4615	7.7	7dsl:B, 7dsn:B, 7dsq:B, 8ida:B, 6irt:B, 8j8l:B, 8j8m:B, 8xpu:B
12	6jmq:A	403	39	0.0614	0.0447	0.4615	9.9

[Back]