MLVDLNVPWPQNSYADKVTSQAVNNLIKTLSTLHMLGYTHIAINFTVNHSEKFPNDVKLLNPIDIKRRFGELMDRTGLKL
YSRITLIIDDPSKGQSLSKISQAFDIVAALPISEKGLTLSTTNLDIDLLTFQYGSRLPTFLKHKSICSCVNRGVKLEIVY
GYALRDVQARRQFVSNVRSVIRSSRSRGIVIGSGAMSPLECRNILGVTSLIKNLGLPSDRCSKAMGDLASLVLLNGRLRN
KS
The query sequence (length=242) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6agb:J | 293 | 242 | 1.0000 | 0.8259 | 1.0000 | 6.96e-179 | 6agb:I, 6ah3:I, 6ah3:J, 7c79:I, 7c79:J, 7c7a:I, 7c7a:J, 6w6v:I, 6w6v:J |
2 | 6ahr:J | 247 | 229 | 0.2727 | 0.2672 | 0.2882 | 1.12e-25 | 6ahr:I, 6ahu:I, 6ahu:J |
3 | 1b33:A | 160 | 49 | 0.0785 | 0.1187 | 0.3878 | 0.87 | 6yx7:KKK, 6yx8:AAA, 6yx8:CCC, 6yx8:EEE |
4 | 8tj8:A | 317 | 43 | 0.0537 | 0.0410 | 0.3023 | 0.89 | |
5 | 8jzd:A | 166 | 90 | 0.0992 | 0.1446 | 0.2667 | 0.89 | 8jzd:C |
6 | 6gwj:K | 334 | 61 | 0.0702 | 0.0509 | 0.2787 | 0.93 | |
7 | 8k20:A | 337 | 61 | 0.0661 | 0.0475 | 0.2623 | 1.9 | |
8 | 2c2g:A | 448 | 47 | 0.0702 | 0.0379 | 0.3617 | 1.9 | 2c2b:A, 2c2b:B, 2c2b:C, 2c2b:D, 2c2b:E, 2c2b:F, 2c2g:B |
9 | 2a1u:B | 252 | 110 | 0.1157 | 0.1111 | 0.2545 | 2.3 | 2a1t:S, 1efv:B, 1t9g:S |
10 | 7dsk:B | 464 | 39 | 0.0744 | 0.0388 | 0.4615 | 4.0 | 7dsl:B, 7dsn:B, 7dsq:B, 8ida:B, 6irt:B, 8j8l:B, 8j8m:B, 8xpu:B |
11 | 6jmq:A | 403 | 39 | 0.0744 | 0.0447 | 0.4615 | 4.6 |