MLVAYDSMTGNVKRFIHKLNMPAVQIDEDLVIDEDFILITYTTGFGNVPERVLDFLERNNEKLKGVSASGNRNWGDMFGA
SADKISTKYEVPIVSKFELSGTNNDVEYFKERVREIA
The query sequence (length=117) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4bmo:B | 118 | 117 | 1.0000 | 0.9915 | 1.0000 | 3.85e-84 | 4bmp:B, 2x2o:A, 2x2p:A, 2xod:A, 2xoe:A, 7z3d:B, 7z3e:B |
2 | 1rlj:A | 135 | 115 | 0.4872 | 0.4222 | 0.4957 | 9.44e-36 | |
3 | 3n3a:C | 131 | 125 | 0.4444 | 0.3969 | 0.4160 | 1.73e-24 | 3n39:C, 3n39:D, 3n3a:D, 3n3b:C, 3n3b:D |
4 | 7mmq:G | 124 | 113 | 0.3590 | 0.3387 | 0.3717 | 2.92e-19 | |
5 | 7mmp:E | 139 | 125 | 0.3846 | 0.3237 | 0.3600 | 1.63e-18 | 6ebq:A, 6ebq:B, 7mmp:G, 7mmp:F, 7mmp:H, 7mmq:E, 7mmq:F, 7mmq:H, 7mmr:E, 7mmr:G, 7mmr:F, 7mmr:H, 7mms:E, 7mms:G, 7mms:F, 7mms:H |
6 | 4n82:B | 153 | 136 | 0.3248 | 0.2484 | 0.2794 | 7.27e-07 | 4n82:A |
7 | 5lji:A | 145 | 140 | 0.3504 | 0.2828 | 0.2929 | 2.52e-04 | 5lji:C |
8 | 5veg:B | 149 | 99 | 0.2222 | 0.1745 | 0.2626 | 0.056 | 5veg:A, 5veg:C |
9 | 6gaq:A | 146 | 85 | 0.1795 | 0.1438 | 0.2471 | 0.46 | 6gaq:B |
10 | 3d6y:A | 277 | 104 | 0.2650 | 0.1119 | 0.2981 | 0.84 | 1bow:A, 7ckq:G, 7ckq:I, 3d6z:A, 3d70:A, 3d71:A, 1exi:A, 1exj:A, 3q1m:A, 3q2y:A, 3q3d:A, 3q5p:A, 3q5r:A, 3q5s:A, 1r8e:A |
11 | 1r0l:B | 379 | 43 | 0.1026 | 0.0317 | 0.2791 | 0.97 | 1r0l:A, 1r0l:C, 1r0l:D |
12 | 6ldk:A | 813 | 82 | 0.1880 | 0.0271 | 0.2683 | 4.4 | |
13 | 6rm3:LDD | 102 | 47 | 0.1197 | 0.1373 | 0.2979 | 7.2 | |
14 | 8tjc:B | 336 | 25 | 0.0855 | 0.0298 | 0.4000 | 8.3 | 7jhi:A, 7jhi:C, 7jhl:A, 7jhl:B, 7jhm:A, 7jhm:B, 7jhn:A, 7jho:A, 7jho:B, 8sz3:A, 8sz3:B, 8tic:A, 8tic:B, 8tic:C, 8tic:D, 8tjc:A, 8tjc:C, 8tjc:D, 6wmm:A, 6wmm:B, 6wmn:A, 6wmn:B, 6wmn:C, 6wmn:D, 6wmo:A, 6wmo:B |
15 | 5lhd:C | 905 | 47 | 0.1111 | 0.0144 | 0.2766 | 8.6 | 6atk:C, 6atk:A, 6atk:B, 4fyq:A, 4fyr:A, 4fys:A, 4fyt:A, 5lhd:D, 5lhd:A, 5lhd:B, 6u7e:A, 6u7e:B, 6u7f:A, 6u7f:B, 6u7g:A, 6u7g:B, 7vpq:A, 7vpq:C, 7vpq:E |
16 | 7pwe:A | 194 | 80 | 0.1624 | 0.0979 | 0.2375 | 9.6 | 7pwe:B |