MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPH
MKAYSEAVKGDVLEMNIRILQPG
The query sequence (length=103) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1tuv:A | 103 | 103 | 1.0000 | 1.0000 | 1.0000 | 2.07e-74 | |
2 | 3kkf:A | 105 | 31 | 0.0971 | 0.0952 | 0.3226 | 0.87 | |
3 | 6s9u:A | 520 | 26 | 0.0874 | 0.0173 | 0.3462 | 2.2 | |
4 | 4ka7:A | 695 | 36 | 0.1165 | 0.0173 | 0.3333 | 5.3 | 4ka8:A, 4put:A |
5 | 3wdv:A | 298 | 28 | 0.1068 | 0.0369 | 0.3929 | 8.8 | 3wdu:A, 3wdu:B, 3wdu:C, 3wdu:D, 3wdv:B, 3wdv:C, 3wdv:D, 3wdx:A, 3wdx:B, 3wdy:A, 3wdy:B, 3wdy:C, 3wdy:D |
6 | 1x8d:A | 104 | 40 | 0.1359 | 0.1346 | 0.3500 | 9.3 | 1x8d:B, 1x8d:C, 1x8d:D |