MLTEKRVCRFCLTEQKLASIFEETANLPLQIMAITAIEVYAGDGMPGHICLECRLLFEHCYRFKQMCKRAETLLRQYPLT
GNWPSPLEKPRAP
The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7pok:A | 98 | 95 | 0.9570 | 0.9082 | 0.9368 | 2.59e-61 | 7pok:B, 7pok:C, 7pok:D |
2 | 6lpw:B | 436 | 80 | 0.2043 | 0.0436 | 0.2375 | 0.23 | |
3 | 7tvb:A | 558 | 54 | 0.1935 | 0.0323 | 0.3333 | 0.92 | 7tva:A, 7tva:B, 7ubt:A, 7uc6:A, 7uc7:A |
4 | 1nd6:B | 343 | 57 | 0.2473 | 0.0671 | 0.4035 | 2.5 | 1cvi:A, 1cvi:B, 1cvi:C, 1cvi:D, 2hpa:A, 2hpa:B, 2hpa:D, 1nd5:A, 1nd5:B, 1nd5:C, 1nd5:D, 1nd6:A, 1nd6:C, 1nd6:D |
5 | 3u5m:E | 173 | 32 | 0.1075 | 0.0578 | 0.3125 | 3.4 | |
6 | 4euk:A | 136 | 20 | 0.0968 | 0.0662 | 0.4500 | 3.7 | |
7 | 3u5o:C | 195 | 37 | 0.1075 | 0.0513 | 0.2703 | 5.5 | 8bd8:A, 8bd9:A, 8bdy:A, 5mr8:A, 3u5m:A, 3u5m:B, 3u5m:C, 3u5m:D, 3u5m:F, 3u5m:G, 3u5m:H, 3u5m:I, 3u5m:K, 3u5m:J, 3u5m:L, 3u5n:A, 3u5n:B, 3u5o:A, 3u5o:B, 3u5o:D, 3u5o:E, 3u5o:F, 3u5o:G, 3u5o:H, 3u5p:A, 3u5p:B, 3u5p:C, 3u5p:D, 3u5p:E, 3u5p:F, 3u5p:G, 3u5p:H, 7zdd:A |
8 | 2ww8:A | 815 | 21 | 0.1075 | 0.0123 | 0.4762 | 8.5 | |
9 | 6fp5:B | 86 | 32 | 0.1183 | 0.1279 | 0.3438 | 9.2 | 6fp5:A |