MLRNKILAAISQKIPEEQKINKYIEGLFQSIDKNHLATHVAKFTETNSPGNIGAYDILSSDMNCGYLDTANAGWKEPDIV
TNDAKYKRPQGFVAMEMSDGRTVMEHLQEDSAELRHEMEELTDKYDEIRDGILNMPSMQPYRTNQFIKQVFFPVGGSYHL
LSILPSTVLNYEVSDRLYRSKIPKIRLRLLSSNAASTTGSRLVSKNKWPLVFQALPPKFLEKNLAKALDKEYLLPDINID
ELEGVDNGCLIDEALLPLIIDEGKRKGEGNYRPRHLRDERKEETVQAFLDKYGYCNIPVGYEVHHIVPLSQGGADSIKNM
IMLSIEHHERVTEAHASYFK
The query sequence (length=340) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8w1p:G | 340 | 339 | 0.9971 | 0.9971 | 1.0000 | 0.0 | 8ydb:J, 8yeo:J |
2 | 8yh9:J | 242 | 200 | 0.5882 | 0.8264 | 1.0000 | 9.41e-148 | |
3 | 8yh9:J | 242 | 42 | 0.1235 | 0.1736 | 1.0000 | 9.37e-23 | |
4 | 6ghc:B | 286 | 27 | 0.0412 | 0.0490 | 0.5185 | 0.018 | 6ghc:A, 6r64:A, 6r64:B, 6t21:A, 6t21:B, 6t22:A, 6t22:B |
5 | 8csz:D | 494 | 28 | 0.0324 | 0.0223 | 0.3929 | 1.5 | |
6 | 8d2q:A | 906 | 32 | 0.0324 | 0.0121 | 0.3438 | 3.5 | |
7 | 6erp:A | 1011 | 81 | 0.0676 | 0.0227 | 0.2840 | 3.7 | 6erp:B, 6erq:A, 6erq:B |
8 | 6f6t:B | 677 | 56 | 0.0559 | 0.0281 | 0.3393 | 6.6 | 6f6t:A, 6hqf:A, 6hqf:B |