MLQGKTIVLDPGHGGSDQGASSNTKYKSLEKDYTLKTAKELQRTLEKEGATVKMTRTDDTYVSLENRDIKGDAYLSIHND
ALESSNANGMTVYWYHDNQRALADTLDATIQKKGLLSNRGSRQENYQVLAQTKVPAVLLELGYISNPTDETMIKDQLHRQ
ILEQAIVDGLKIYFSA
The query sequence (length=176) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7tj4:B | 176 | 176 | 1.0000 | 1.0000 | 1.0000 | 8.08e-130 | 7tj4:D |
2 | 4rn7:A | 186 | 181 | 0.3580 | 0.3387 | 0.3481 | 7.01e-30 | |
3 | 5emi:A | 180 | 175 | 0.3239 | 0.3167 | 0.3257 | 1.35e-25 | |
4 | 1jwq:A | 179 | 175 | 0.3295 | 0.3240 | 0.3314 | 4.71e-25 | |
5 | 4bin:A | 348 | 210 | 0.3807 | 0.1925 | 0.3190 | 2.28e-23 | |
6 | 8c2o:A | 228 | 222 | 0.3636 | 0.2807 | 0.2883 | 9.99e-20 | 8c2o:B |
7 | 3ne8:A | 226 | 213 | 0.3636 | 0.2832 | 0.3005 | 7.83e-19 | |
8 | 5j72:A | 638 | 163 | 0.3352 | 0.0925 | 0.3620 | 1.95e-18 | 5j72:B |
9 | 7rag:B | 197 | 200 | 0.3182 | 0.2843 | 0.2800 | 3.84e-17 | |
10 | 8c0j:A | 200 | 196 | 0.3295 | 0.2900 | 0.2959 | 3.57e-16 | 8c0j:C |
11 | 7b3n:B | 170 | 141 | 0.2443 | 0.2529 | 0.3050 | 1.03e-11 | 7b3n:A, 7b3n:C, 7b3n:D, 7b3n:E |
12 | 7ago:A | 214 | 215 | 0.3068 | 0.2523 | 0.2512 | 2.33e-07 | 7agl:A |
13 | 4m6g:A | 214 | 215 | 0.2670 | 0.2196 | 0.2186 | 6.14e-06 | 4lq6:A, 4m6i:A, 4m6i:B |
14 | 7agm:A | 218 | 217 | 0.3011 | 0.2431 | 0.2442 | 1.01e-05 | 7agm:B |
15 | 1xov:A | 315 | 137 | 0.2273 | 0.1270 | 0.2920 | 4.19e-05 | |
16 | 1ji4:A | 144 | 40 | 0.1023 | 0.1250 | 0.4500 | 0.87 | 4evb:A, 4evc:A, 1ji4:D, 1ji4:B, 1ji4:C, 1ji4:E, 1ji4:H, 1ji4:F, 1ji4:G, 1ji4:I, 1ji4:L, 1ji4:J, 1ji4:K |
17 | 6iey:A | 307 | 104 | 0.1420 | 0.0814 | 0.2404 | 1.4 | |
18 | 2vpr:A | 197 | 23 | 0.0682 | 0.0609 | 0.5217 | 1.8 | |
19 | 5jla:D | 259 | 42 | 0.0909 | 0.0618 | 0.3810 | 2.4 | 5jla:A, 5jla:B, 5jla:C |
20 | 2dsx:A | 52 | 39 | 0.0625 | 0.2115 | 0.2821 | 3.7 | 1rdg:A |
21 | 3qs1:A | 327 | 48 | 0.0852 | 0.0459 | 0.3125 | 4.2 | 3qs1:B, 3qs1:C, 3qs1:D |
22 | 6u3j:A | 876 | 39 | 0.0739 | 0.0148 | 0.3333 | 4.8 | 5rvw:A, 5rvw:B, 5rvx:A, 5rvx:B, 5rvy:A, 5rvy:B, 5rvz:A, 5rvz:B, 5rw0:A, 5rw0:B, 5rw1:A, 5rw1:B, 6sy1:A, 6sy1:B, 6u3j:B |
23 | 2cy3:A | 118 | 29 | 0.0682 | 0.1017 | 0.4138 | 7.4 | 1w7o:A |
24 | 5l43:A | 662 | 92 | 0.1534 | 0.0408 | 0.2935 | 9.4 | 5l43:B, 5l44:A, 5l44:B |
25 | 4ici:A | 159 | 46 | 0.1080 | 0.1195 | 0.4130 | 9.5 |