MLPISMSDEGDSFLVKDSLGENKIPKNPSKVVILDLGILDTFDALKLNDKVVGVPAKNLPKYLQQFKNKPSVGGVQQVDF
EAINALKPDLIIISGRQSKFYDKLKEIAPTLFVGLDNANFLSSFENNVLSVAKLYGLEKEALEKISDIKNEIEKAKSIVD
EDKKALIILTNSNKISAFGPQSRFGIIHDVLGINAVDENIKVGTHGKSINSEFILEKNPDYIFVVDRNVILGNKERAQGI
LDNALVAKTKAAQNKKIIYLDPEYWYLASGNGLESLKTMILEIKNAVK
The query sequence (length=288) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ad1:A | 290 | 288 | 1.0000 | 0.9931 | 1.0000 | 0.0 | 5a1j:A, 5a5d:A, 5a5v:A, 5adv:A, 5adv:B, 5adv:C, 5adw:A, 5adw:B, 5adw:C, 2chu:A, 2chu:B, 5lwh:A, 5oah:A, 5oah:B, 5od5:A, 5od5:C, 5tcy:A, 5tcy:B, 5tcy:C |
2 | 8bax:A | 281 | 285 | 0.4792 | 0.4911 | 0.4842 | 3.16e-94 | 8b7x:A, 8baw:A, 8baw:B |
3 | 8bf6:A | 278 | 281 | 0.4861 | 0.5036 | 0.4982 | 1.20e-84 | 8bj9:A |
4 | 3gfv:B | 285 | 279 | 0.4167 | 0.4211 | 0.4301 | 1.93e-80 | |
5 | 6mfl:A | 284 | 279 | 0.2812 | 0.2852 | 0.2903 | 2.21e-41 | 6mfl:B |
6 | 7sf6:A | 294 | 266 | 0.2118 | 0.2075 | 0.2293 | 4.85e-17 | |
7 | 3lhs:A | 291 | 284 | 0.2535 | 0.2509 | 0.2570 | 7.53e-12 | 3li2:A, 3li2:B |
8 | 3tlk:A | 296 | 313 | 0.2465 | 0.2399 | 0.2268 | 1.00e-10 | 3tlk:C, 3tlk:B |
9 | 3tny:A | 280 | 266 | 0.2292 | 0.2357 | 0.2481 | 2.92e-10 | |
10 | 5b50:A | 324 | 287 | 0.2535 | 0.2253 | 0.2544 | 3.51e-07 | 5az3:A, 5b4z:A, 5b51:A |
11 | 3mwf:A | 292 | 133 | 0.1528 | 0.1507 | 0.3308 | 6.88e-07 | |
12 | 2why:A | 283 | 157 | 0.1562 | 0.1590 | 0.2866 | 2.16e-06 | 2xuz:A, 2xv1:A |
13 | 7w8f:A | 278 | 147 | 0.1389 | 0.1439 | 0.2721 | 3.86e-06 | |
14 | 2r7a:A | 255 | 239 | 0.1944 | 0.2196 | 0.2343 | 9.95e-06 | |
15 | 2r79:A | 279 | 227 | 0.1875 | 0.1935 | 0.2379 | 1.10e-05 | |
16 | 5ggx:D | 267 | 168 | 0.1667 | 0.1798 | 0.2857 | 5.40e-05 | 5ggx:A, 5ggx:B, 5ggx:C |
17 | 3r5t:A | 296 | 170 | 0.1424 | 0.1385 | 0.2412 | 3.33e-04 | |
18 | 5jj5:A | 308 | 159 | 0.1424 | 0.1331 | 0.2579 | 0.098 | 4hmq:A, 4hmq:B, 5jj5:B |
19 | 5gj3:A | 270 | 261 | 0.1979 | 0.2111 | 0.2184 | 0.13 | 5y8b:A |
20 | 3psa:A | 326 | 274 | 0.2153 | 0.1902 | 0.2263 | 0.14 | 3psh:A |
21 | 2q8p:A | 258 | 204 | 0.1701 | 0.1899 | 0.2402 | 0.15 | 2q8q:A |
22 | 4mlz:A | 299 | 140 | 0.1181 | 0.1137 | 0.2429 | 0.33 | 4mlz:B |
23 | 6tfo:C | 424 | 83 | 0.0799 | 0.0542 | 0.2771 | 0.66 | 6tfd:A, 6tfd:C, 6tfd:B, 6tfo:A, 6tfo:B |
24 | 5ysc:A | 255 | 256 | 0.1944 | 0.2196 | 0.2188 | 1.3 | |
25 | 7fhp:A | 292 | 74 | 0.0729 | 0.0719 | 0.2838 | 1.9 | |
26 | 4oxq:A | 278 | 65 | 0.0764 | 0.0791 | 0.3385 | 2.5 | 4oxr:A, 4oxr:B |
27 | 7yjm:B | 471 | 72 | 0.0764 | 0.0467 | 0.3056 | 3.7 | 7yjk:B, 7yjk:F, 7yjn:B, 7yjo:B |
28 | 7k5b:B | 4524 | 101 | 0.1007 | 0.0064 | 0.2871 | 4.3 | 8bx8:B, 7k58:B, 7kek:B |
29 | 3pjg:A | 389 | 58 | 0.0729 | 0.0540 | 0.3621 | 5.5 | 3pln:A, 3plr:A |
30 | 3a3c:A | 451 | 86 | 0.0729 | 0.0466 | 0.2442 | 7.1 | 2zxt:A |
31 | 3nu1:A | 254 | 213 | 0.1493 | 0.1693 | 0.2019 | 8.4 | 3nu1:B |
32 | 2oyr:A | 245 | 60 | 0.0590 | 0.0694 | 0.2833 | 8.6 | |
33 | 6t1f:C | 195 | 73 | 0.0694 | 0.1026 | 0.2740 | 9.8 | 7bm8:A, 7bm8:B, 6s6h:A, 6t1f:A, 6t1f:B, 6t1f:D |