MLKVSKSPSLVRLKTRGESVCPISKTVDSFEVSVEYIPRGAVLAIEEFKKMVDSYRGREILHEELAVDLLEKVKAAVNPP
YVKVTVKSYYIGVEVEVVAESGGVP
The query sequence (length=105) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5jyx:B | 109 | 105 | 1.0000 | 0.9633 | 1.0000 | 2.95e-70 | 5jyx:A, 5jyx:E, 5jyx:C, 5jyx:J, 5jyx:D, 5jyx:H, 5jyx:F, 5jyx:O, 5jyx:G, 5jyx:L, 5jyx:I, 5jyx:K, 5jyx:M, 5jyx:N |
2 | 1wm9:A | 185 | 48 | 0.1524 | 0.0865 | 0.3333 | 0.001 | 1wm9:B, 1wm9:C, 1wm9:D, 1wm9:E, 1wuq:A, 1wuq:B, 1wuq:E, 1wuq:C, 1wuq:D, 1wur:A, 1wur:B, 1wur:E, 1wur:C, 1wur:D |
3 | 4f8b:B | 145 | 69 | 0.1524 | 0.1103 | 0.2319 | 0.10 | 4f8b:A, 4f8b:C, 4f8b:D, 4f8b:E, 4fgc:A, 4fgc:B, 4fgc:C, 4fgc:D, 4fgc:E, 5udg:A, 5udg:D, 5udg:E |
4 | 4g5d:A | 283 | 38 | 0.1333 | 0.0495 | 0.3684 | 0.52 | 4g5d:B |
5 | 4rsm:A | 315 | 54 | 0.1143 | 0.0381 | 0.2222 | 0.85 | 4rsm:B, 4rsm:C, 4rsm:D |
6 | 4gba:B | 206 | 33 | 0.1238 | 0.0631 | 0.3939 | 0.88 | 4gba:A |
7 | 4g06:A | 68 | 22 | 0.0857 | 0.1324 | 0.4091 | 0.93 | 6jip:A, 6jiq:A, 5zkl:A |
8 | 8x2i:A | 2303 | 83 | 0.2476 | 0.0113 | 0.3133 | 1.1 | |
9 | 8x2h:A | 2363 | 83 | 0.2476 | 0.0110 | 0.3133 | 1.2 | 8jb5:A, 2vkd:A, 2vkd:B, 2vkd:C, 2vkh:A, 2vkh:B, 2vkh:C, 2vl8:A, 2vl8:B, 2vl8:C |
10 | 2i89:A | 90 | 36 | 0.1143 | 0.1333 | 0.3333 | 1.4 | 2i89:B, 2i89:C, 2i89:D, 1icc:A, 1icc:B, 1icc:D, 1lj0:A, 1lj0:B, 1lj0:C, 1lj0:D, 3mus:B |
11 | 5vpu:A | 509 | 82 | 0.2095 | 0.0432 | 0.2683 | 1.6 | |
12 | 8jsg:A | 167 | 25 | 0.0857 | 0.0539 | 0.3600 | 2.4 | 8jsh:A, 5me0:Z, 5me1:Z |
13 | 1awp:A | 86 | 36 | 0.1143 | 0.1395 | 0.3333 | 3.4 | 1awp:B, 1b5m:A, 1eue:A, 1eue:B, 4hil:A, 4hil:B, 1icc:C, 3mus:A |
14 | 1o9l:A | 468 | 86 | 0.2095 | 0.0470 | 0.2558 | 3.9 | 3k6m:C, 2nrb:A, 3oxo:E, 3oxo:F, 3oxo:G, 3oxo:H |
15 | 7yb2:D | 264 | 35 | 0.1333 | 0.0530 | 0.4000 | 5.0 | 8hfj:A, 8hfj:B, 8hfj:C, 8hfj:D, 8hfk:A, 8hfk:B, 8hfk:C, 8hfk:D, 7yb1:D, 7yb1:A, 7yb1:B, 7yb1:C, 7yb2:A, 7yb2:B, 7yb2:C |
16 | 4xuk:A | 291 | 94 | 0.2286 | 0.0825 | 0.2553 | 5.6 | 4xuk:B |
17 | 5ugh:B | 365 | 59 | 0.2095 | 0.0603 | 0.3729 | 8.1 | 6fbn:B, 4ktt:A, 4ktt:C, 4ktv:C, 4ndn:C, 7rw5:D |
18 | 8q6p:7 | 298 | 52 | 0.1619 | 0.0570 | 0.3269 | 8.3 | |
19 | 2ohf:A | 327 | 56 | 0.1619 | 0.0520 | 0.3036 | 8.7 | |
20 | 7t7t:A | 466 | 74 | 0.2190 | 0.0494 | 0.3108 | 9.6 | 7t7t:B |
21 | 7mbm:A | 339 | 29 | 0.0952 | 0.0295 | 0.3448 | 9.9 | 5ov3:B, 6pwv:A, 6pww:A, 6pwx:A, 6w5n:A |