MLKTISPLISPELLKVLAEMGHGDEIIFSDAHFPAHSMGPQVIRADGLLVSDLLQAIIPLFELDSYAPPLVMMAAVEGDT
LDPEVERRYRNALSLQAPCPDIIRINRFAFYERAQKAFAIVITGERAKYGNILLKKGVTP
The query sequence (length=140) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2wcv:B | 140 | 140 | 1.0000 | 1.0000 | 1.0000 | 8.10e-101 | 2wcv:A, 2wcv:C, 2wcv:D, 2wcv:E, 2wcv:F, 2wcv:G, 2wcv:H, 2wcv:I, 2wcv:J |
2 | 2wcu:A | 149 | 145 | 0.5143 | 0.4832 | 0.4966 | 6.17e-37 | 2wcu:B |
3 | 4a34:I | 142 | 139 | 0.4500 | 0.4437 | 0.4532 | 4.12e-33 | 4a34:A, 4a34:B, 4a34:C, 4a34:D, 4a34:E, 4a34:F, 4a34:G, 4a34:H, 4a34:J, 4a34:K, 4a34:O, 4a34:L, 4a34:M, 4a34:N, 4a34:P, 4a34:Q, 4a34:R, 4a34:S, 4a34:T |
4 | 1ogd:A | 131 | 137 | 0.2786 | 0.2977 | 0.2847 | 4.60e-05 | 1ogd:B, 1ogd:C, 1ogd:D, 1ogd:E, 1oge:A, 1oge:B, 1oge:C, 1oge:D, 1oge:E |
5 | 8hkx:S27E | 59 | 48 | 0.0929 | 0.2203 | 0.2708 | 0.65 | 8hky:S27E, 8hkz:S27E, 8hl1:S27E, 8hl2:S27E, 8hl3:S27E, 8hl4:S27E, 8hl5:S27E, 8wkp:S27E, 8wq2:S27E, 8wq4:S27E |
6 | 6l7o:A | 371 | 93 | 0.1786 | 0.0674 | 0.2688 | 2.8 | 6l7p:A |
7 | 7n59:A | 590 | 74 | 0.1571 | 0.0373 | 0.2973 | 3.6 | 7n59:B, 7n5a:A, 7n5a:B, 7n5b:A, 7n5b:B |
8 | 7y7u:A | 288 | 36 | 0.0929 | 0.0451 | 0.3611 | 4.3 | 7y7u:B |
9 | 1e19:A | 313 | 35 | 0.0929 | 0.0415 | 0.3714 | 5.4 | 1e19:B |
10 | 6msj:B | 411 | 102 | 0.2000 | 0.0681 | 0.2745 | 9.5 | 8cvt:B, 5gjq:I, 5gjr:I, 5gjr:w, 5l4g:I, 5m32:d, 6msb:B, 6msd:B, 6mse:B, 6msk:B, 7qxn:B, 7qxp:B, 7qxu:B, 7qxw:B, 7qxx:B, 7qy7:B, 7qyb:B, 5t0c:AB, 5t0c:BB, 5t0g:B, 5t0h:B, 5t0i:B, 5vfp:B, 5vfq:B, 5vfr:B, 5vfs:B, 7w37:B, 7w38:B, 7w39:B, 7w3a:B, 7w3c:B, 7w3f:B, 7w3g:B, 7w3h:B, 7w3i:B, 7w3j:B, 7w3k:B, 6wjd:B, 6wjn:B |