MLKMEAVPLRLEHRQEVIDIIVASFYNKADLEQWLKPGVLRTDYSDILNDIWNVLVERDLSFVVYDTNTDRIIGTALNFD
ARNEPEVDIKSKLLIVFEFLEFCEGPIRDNYLPKGLNQILHSFMMGTAEKLNPRENIACMHFMEHEVLRVAREKQFAGIF
TTNTSPLTQQLADVYHYKTLLNFQVNEYVHSDGSRPFGDAPDEQRAIVHWKEV
The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6dym:A | 213 | 213 | 1.0000 | 1.0000 | 1.0000 | 8.55e-162 | 6dyn:A, 6dyo:A, 6dyr:A, 6dys:A |
2 | 7wi7:A | 565 | 104 | 0.1268 | 0.0478 | 0.2596 | 2.1 | |
3 | 8pkp:N | 652 | 115 | 0.1362 | 0.0445 | 0.2522 | 2.3 | 9gaw:N |
4 | 8bcv:G | 94 | 69 | 0.0798 | 0.1809 | 0.2464 | 3.0 | |
5 | 8w1p:A | 325 | 64 | 0.0704 | 0.0462 | 0.2344 | 6.0 | 8w1p:B, 8w1p:C, 8w1p:D, 8w1p:E, 8ydb:I, 8ydb:H, 8ydb:G, 8ydb:F, 8ydb:E, 8yeo:I, 8yeo:E, 8yeo:F, 8yeo:G, 8yeo:H, 8yh9:H, 8yh9:G, 8yh9:E, 8yh9:D |
6 | 8s91:A | 602 | 91 | 0.1127 | 0.0399 | 0.2637 | 8.2 | 7dp3:A, 8s91:B, 8s91:C, 8s94:A, 8s94:C, 8s94:B |
7 | 3f1j:A | 140 | 68 | 0.0798 | 0.1214 | 0.2500 | 9.9 | 4hi5:A, 4hi6:A, 4hi6:D, 4hi6:B, 4hiu:A |