MLKHQKYVYVDIGDQKKFLKVRFLKSRSENNNPEAYVILDKISIKLPRNAKVIKYEDLPAEVKDKLKLKL
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8hku:L46A | 70 | 70 | 1.0000 | 1.0000 | 1.0000 | 1.05e-44 | 8hkv:L46A, 8hky:L46A, 8hkz:L46A, 8hl1:L46A, 8hl2:L46A, 8hl3:L46A, 8hl4:L46A, 8hl5:L46A |
2 | 3o8l:A | 748 | 37 | 0.1857 | 0.0174 | 0.3514 | 2.6 | 3o8l:B, 3o8n:A, 3o8n:B |
3 | 5a4f:L | 581 | 19 | 0.1429 | 0.0172 | 0.5263 | 3.4 | 5a4f:M, 5a4i:L, 5a4i:M, 5a4m:L, 5a4m:M, 5adu:L, 5adu:M, 6fpi:L, 6fpi:M, 6fpo:L, 6fpo:M, 6fpw:L, 6fpw:M, 6g7r:L, 6g7r:M, 6g94:L, 6g94:M, 6g94:J, 6g94:K, 6gal:L, 6gal:M, 4gd3:L, 4gd3:M, 4gd3:J, 4gd3:K, 5jrd:L, 5jrd:M, 5lmm:L, 5lmm:M, 5lry:L, 5lry:M, 6rp2:L, 6rp2:M, 4ue3:LLL, 4ue3:MMM, 3uqy:L, 3uqy:M, 3usc:L, 3usc:M, 3use:L, 3use:M |
4 | 6lja:A | 841 | 27 | 0.1714 | 0.0143 | 0.4444 | 5.5 | 6ljl:A |
5 | 5xnd:A | 110 | 28 | 0.1429 | 0.0909 | 0.3571 | 9.5 |