MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
The query sequence (length=132) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6ifc:A | 132 | 132 | 1.0000 | 1.0000 | 1.0000 | 1.36e-97 | 6ifc:C, 6ifc:E, 6ifc:G |
| 2 | 5ecd:A | 132 | 130 | 0.7652 | 0.7652 | 0.7769 | 9.53e-77 | 5ecd:B |
| 3 | 8uat:F | 351 | 74 | 0.1818 | 0.0684 | 0.3243 | 1.0 | 3hf3:A, 3hf3:B, 3hf3:C, 3hf3:D, 3hgj:A, 3hgj:B, 3hgj:C, 3hgj:D, 5nux:A, 5nux:B, 5nux:C, 5nux:D, 5ogt:A, 5ogt:B, 5ogt:C, 5ogt:D, 8uaj:A, 8uaj:B, 8uaj:C, 8uaj:D, 8uat:B, 8uat:C, 8uat:D, 8uat:E, 8uat:G, 8uat:H, 8uat:A |
| 4 | 7vpp:A | 904 | 54 | 0.1136 | 0.0166 | 0.2778 | 1.2 | 6buy:A, 6bv0:A, 6bv1:A, 6bv2:A, 6bv3:A, 6bv4:A, 4f5c:A, 4f5c:B, 4fke:A, 4fkh:A, 4fkk:A, 4hom:A, 5lds:D, 5lds:A, 5lds:B, 5lds:C, 5lg6:A, 5lg6:B, 4naq:A, 4nz8:A, 4ou3:A, 7vpp:C, 5z65:A |
| 5 | 3e27:C | 189 | 61 | 0.1364 | 0.0952 | 0.2951 | 1.3 | 3e27:A, 3e27:B, 3e27:D, 3hfj:A, 3hfj:B, 3mla:A, 3mla:B, 3mlb:A, 3mlb:B, 3mmx:B, 3mmx:C, 3mmx:A, 3mmx:D, 2qtn:B, 2qtr:A, 2qtr:B, 2qtr:C |
| 6 | 3eo7:A | 487 | 57 | 0.1515 | 0.0411 | 0.3509 | 2.8 | |
| 7 | 2uz9:A | 444 | 35 | 0.0909 | 0.0270 | 0.3429 | 4.2 | 4aql:A, 3e0l:A, 3e0l:B |
| 8 | 4fvv:B | 415 | 38 | 0.0833 | 0.0265 | 0.2895 | 5.1 | 4isq:C, 4isq:A, 4isq:B, 4isr:A, 4isr:B, 4isr:C, 5lr0:A, 5lr0:B |
| 9 | 3r4s:A | 424 | 56 | 0.1136 | 0.0354 | 0.2679 | 7.5 | 3r4s:B |
| 10 | 6hwj:A | 428 | 64 | 0.1439 | 0.0444 | 0.2969 | 9.9 | 6hwj:B, 6hwk:A, 6hwk:C, 6hwk:D, 6hwl:B |
umich.edu