MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQA
The query sequence (length=53) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2mf0:A | 59 | 53 | 1.0000 | 0.8983 | 1.0000 | 2.05e-32 | 2jpp:A, 2jpp:B, 2mf0:B, 2mf0:C, 2mf0:D, 2mf0:E, 2mf0:F, 2mf1:A, 2mf1:B, 2mf1:C, 2mf1:D, 2mf1:E, 2mf1:F, 2mfc:A, 2mfc:C, 2mfe:A, 2mfe:C, 2mff:A, 2mff:C, 2mfg:A, 2mfg:C, 2mfh:A, 2mfh:C |
2 | 7yr6:E | 55 | 52 | 0.7547 | 0.7273 | 0.7692 | 1.91e-26 | 7yr6:D, 7yr6:C, 7yr6:B, 7yr7:F, 7yr7:E, 7yr7:G, 7yr7:B, 7yr7:C, 7yr7:D |
3 | 4kji:B | 65 | 63 | 0.3585 | 0.2923 | 0.3016 | 0.035 | 4kji:A |
4 | 4rk9:A | 384 | 31 | 0.1887 | 0.0260 | 0.3226 | 0.51 | 4rk9:B |
5 | 2idv:A | 177 | 37 | 0.2264 | 0.0678 | 0.3243 | 3.1 | |
6 | 3c5m:B | 378 | 38 | 0.2453 | 0.0344 | 0.3421 | 6.0 | 3c5m:A, 3c5m:C |
7 | 3v0r:A | 130 | 39 | 0.2642 | 0.1077 | 0.3590 | 8.0 | |
8 | 2reg:A | 290 | 29 | 0.1698 | 0.0310 | 0.3103 | 9.5 | 2reg:B, 2rin:A, 2rin:B |