MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVF
LGAVGVVETLKEFSIDGRIKWPNDVLVNYKGIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSL
ITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
The query sequence (length=235) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2deq:A | 235 | 235 | 1.0000 | 1.0000 | 1.0000 | 1.11e-167 | 2deq:B, 2djz:A, 2djz:B, 2dkg:A, 2dkg:B, 2dth:A, 2dth:B, 2dti:A, 2dti:B, 2dto:A, 2dto:B, 2dve:A, 2dve:B, 2dxt:A, 2dxt:B, 2dxu:A, 2dxu:B, 2dz9:A, 2dz9:B, 2e41:A, 2e41:B, 2ejf:A, 2ejf:B, 2ejg:A, 2ejg:B, 2fyk:A, 2fyk:B, 1wnl:A, 1wnl:B, 1wpy:A, 1wpy:B, 1wqw:A, 1wqw:B, 1x01:A, 1x01:B, 2zgw:A, 2zgw:B |
2 | 6ndl:A | 323 | 239 | 0.3064 | 0.2229 | 0.3013 | 2.00e-27 | 6apw:A, 6aqq:A, 4dq2:A, 8eni:A, 4ha8:A, 6oru:A, 3rir:A, 3rkw:A, 3rky:A, 3v7c:A, 3v7r:A, 3v7s:A, 3v8k:A, 3v8l:A |
3 | 3efr:A | 233 | 233 | 0.3319 | 0.3348 | 0.3348 | 2.26e-25 | 3efr:B, 3efs:A, 3efs:B |
4 | 2ej9:A | 237 | 203 | 0.3064 | 0.3038 | 0.3547 | 3.28e-24 | |
5 | 7dbs:A | 252 | 172 | 0.2128 | 0.1984 | 0.2907 | 5.59e-15 | 6jhu:A |
6 | 8fi3:B | 308 | 237 | 0.3234 | 0.2468 | 0.3207 | 1.92e-14 | 8fi3:A |
7 | 2ewn:A | 318 | 235 | 0.3191 | 0.2358 | 0.3191 | 2.83e-14 | 2ewn:B, 1hxd:A, 1hxd:B, 4wf2:A |
8 | 9j8e:B | 296 | 242 | 0.2809 | 0.2230 | 0.2727 | 2.36e-13 | 9j8e:A |
9 | 4xtu:A | 266 | 223 | 0.3021 | 0.2669 | 0.3184 | 2.87e-13 | 4op0:A, 4op0:B, 3rux:A, 3rux:B, 4xtu:B, 4xtv:A, 4xtv:B, 4xtw:A, 4xtw:B, 4xtx:A, 4xtx:B, 4xty:A, 4xty:B, 4xtz:A, 4xtz:B, 4xu0:A, 4xu0:B, 4xu1:A, 4xu1:B, 4xu2:A, 4xu2:B, 4xu3:A, 4xu3:B |
10 | 1bib:A | 294 | 220 | 0.2766 | 0.2211 | 0.2955 | 4.66e-11 | |
11 | 6ck0:B | 210 | 123 | 0.1745 | 0.1952 | 0.3333 | 2.34e-08 | 6ck0:A |
12 | 4fns:A | 718 | 56 | 0.0766 | 0.0251 | 0.3214 | 2.0 | 4fns:B, 4fns:C, 4fns:D, 4fnt:C, 4fnt:B, 4fnt:A, 4fnt:D, 4fnu:A, 4fnu:B, 4fnu:C, 4fnu:D |
13 | 8em4:A | 3818 | 60 | 0.0766 | 0.0047 | 0.3000 | 3.3 | 8em4:B |
14 | 8em7:A | 4378 | 60 | 0.0766 | 0.0041 | 0.3000 | 3.3 | 8em7:B, 8jut:A, 8jut:B, 8juu:B, 8juu:A, 8jx8:B, 8jx8:A, 8jx9:B, 8jxa:A, 8jxb:A, 8jxd:A, 8jxe:A, 8jxe:B, 8jxf:B, 8jxg:A, 8jxh:A, 8jxi:B |
15 | 6jmg:A | 267 | 82 | 0.1021 | 0.0899 | 0.2927 | 4.3 | 6jmg:B |
16 | 3tii:B | 313 | 56 | 0.0596 | 0.0447 | 0.2500 | 5.3 | 3tig:A, 3tii:A, 3tin:A |
17 | 6idn:A | 272 | 81 | 0.1064 | 0.0919 | 0.3086 | 7.4 | |
18 | 4kpp:A | 395 | 67 | 0.0681 | 0.0405 | 0.2388 | 8.0 | 4kpp:B |