MLELLLLTSELYPDPVLPALSLLPHTVRTAPAEASSLLEAGNADAVLVDARNDLSSGRGLCRLLSSTGRSIPVLAVVSEG
GLVAVSADWGLDEILLLSTGPAEIDARLRLVVGLGKVSLGELVIDEGTYTARLRGRPLDLTYKEFELLKYLAQHAGRVFT
RAQLLHEVWGYDFFGGTRTVDVHVRRLRAKLGPEHEALIGTVRNVGYKAVRPA
The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8hih:O | 217 | 217 | 1.0000 | 0.9816 | 0.9816 | 8.55e-149 | 8hih:P, 8hih:N, 8hih:Q |
2 | 8hig:A | 98 | 101 | 0.3756 | 0.8163 | 0.7921 | 2.32e-52 | 8hig:B, 8hml:A, 8hml:B |
3 | 6cqg:A | 98 | 93 | 0.2300 | 0.5000 | 0.5269 | 7.92e-24 | |
4 | 2oqr:A | 226 | 196 | 0.3146 | 0.2965 | 0.3418 | 1.64e-23 | |
5 | 7e1b:A | 209 | 190 | 0.3427 | 0.3493 | 0.3842 | 2.28e-18 | 7e1b:B, 7e1b:C, 7e1b:H, 7e1b:D, 7e1b:E, 7e1b:F, 7e1b:G, 7e1h:A, 7e1h:B, 7e1h:E |
6 | 4b09:A | 218 | 192 | 0.2723 | 0.2661 | 0.3021 | 2.16e-17 | 4b09:B, 4b09:C, 4b09:D, 4b09:E, 4b09:F, 4b09:G, 4b09:I, 4b09:K |
7 | 2gwr:A | 225 | 178 | 0.2958 | 0.2800 | 0.3539 | 2.20e-17 | 3nhz:B, 3nhz:C, 3nhz:D |
8 | 5ed4:E | 224 | 197 | 0.2770 | 0.2634 | 0.2995 | 1.51e-16 | 5ed4:A, 5ed4:B, 5ed4:F, 2pmu:E |
9 | 1ys6:B | 227 | 95 | 0.2066 | 0.1938 | 0.4632 | 1.89e-16 | 1ys6:A, 1ys7:A, 1ys7:B |
10 | 2z33:A | 104 | 73 | 0.1596 | 0.3269 | 0.4658 | 2.73e-16 | 1gxp:A, 1gxp:B, 1gxp:E, 1gxp:F |
11 | 8uvx:A | 222 | 112 | 0.1690 | 0.1622 | 0.3214 | 3.44e-11 | 8uvk:A, 8uvk:B, 8uvx:B |
12 | 4nhj:A | 102 | 93 | 0.1690 | 0.3529 | 0.3871 | 5.93e-11 | 4nhj:B |
13 | 8jo2:H | 219 | 126 | 0.1925 | 0.1872 | 0.3254 | 6.02e-09 | 8jo2:I, 4s04:A, 4s04:B, 4s04:E, 4s04:F, 4s05:A, 4s05:B, 3w9s:A, 3w9s:B |
14 | 5x5l:E | 98 | 90 | 0.1408 | 0.3061 | 0.3333 | 7.75e-07 | 5x5l:B, 5x5l:H, 5x5l:A |
15 | 6lxn:A | 110 | 93 | 0.1315 | 0.2545 | 0.3011 | 8.78e-07 | 6lxn:B |
16 | 4kny:B | 226 | 146 | 0.1925 | 0.1814 | 0.2808 | 2.41e-06 | 4kfc:A, 4kfc:B, 4kny:A, 1zh2:A, 1zh2:B, 1zh4:A, 1zh4:B |
17 | 5ju7:A | 107 | 100 | 0.1408 | 0.2804 | 0.3000 | 1.34e-05 | |
18 | 7lza:A | 219 | 74 | 0.1221 | 0.1187 | 0.3514 | 2.71e-04 | 7lz9:A |
19 | 7bkb:L | 79 | 31 | 0.0469 | 0.1266 | 0.3226 | 0.82 | 7bkb:l, 7bkc:L, 7bkc:l |
20 | 5cvi:B | 215 | 37 | 0.0657 | 0.0651 | 0.3784 | 2.6 | 5cvi:A |
21 | 5l4g:M | 415 | 69 | 0.1080 | 0.0554 | 0.3333 | 3.0 | 5m32:g, 6msd:F, 6mse:F, 7qxw:F, 5t0c:AF, 5t0c:BF, 5t0g:F, 5t0h:F, 5t0i:F, 5t0j:F, 7w38:F, 7w39:F, 7w3a:F, 7w3i:F, 7w3j:F, 7w3k:F, 6wjd:F |
22 | 2a5z:C | 244 | 133 | 0.1596 | 0.1393 | 0.2556 | 4.8 | 2a5z:A, 2a5z:B |
23 | 4zas:A | 369 | 76 | 0.1221 | 0.0705 | 0.3421 | 5.2 | 4zas:B, 4zas:D, 4zas:E, 4zas:F |
24 | 2jlb:A | 548 | 47 | 0.0845 | 0.0328 | 0.3830 | 6.9 | 2jlb:B, 2vsn:A, 2vsn:B, 2xgm:A, 2xgm:B, 2xgo:A, 2xgs:A, 2xgs:B |
25 | 6pd2:C | 616 | 105 | 0.1408 | 0.0487 | 0.2857 | 8.1 | 6pd1:A, 6pd1:B, 6pd1:D, 6pd2:A, 6pd2:B, 6pd2:D |
26 | 6ppo:B | 235 | 51 | 0.0704 | 0.0638 | 0.2941 | 9.8 | 6psf:B |