MKWNLDPSHTSIDFKVRHMGIASVRGSLKVLSGSVETDEAGRPIQVEAVIDAASIATGEPQRDGHLRSADFLHAEQYPEI
RFVSTQIEPLGGNRYRIQGNLTIRDITKPVTLEAEVSAPIKDPWGMQRVAASASGQINRKDWNLTWNQVLELGALLVGEE
VKFNLEVEAVAPAPVA
The query sequence (length=176) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1wub:A | 176 | 176 | 1.0000 | 1.0000 | 1.0000 | 1.76e-129 | |
2 | 1y0g:A | 169 | 163 | 0.3352 | 0.3491 | 0.3620 | 4.06e-30 | 1y0g:B, 1y0g:C, 1y0g:D |
3 | 5w2r:A | 171 | 168 | 0.2784 | 0.2865 | 0.2917 | 4.90e-29 | 5w2z:A, 5w30:A, 5w39:A, 5w3a:A, 5w3c:A |
4 | 3hpe:A | 164 | 171 | 0.3239 | 0.3476 | 0.3333 | 6.87e-28 | 3hpe:B |
5 | 7bwl:A | 168 | 163 | 0.3068 | 0.3214 | 0.3313 | 6.89e-25 | |
6 | 5ixg:B | 169 | 166 | 0.3068 | 0.3195 | 0.3253 | 1.38e-21 | 5ixg:C, 5ixg:A, 5ixg:D |
7 | 5ixh:B | 161 | 115 | 0.2045 | 0.2236 | 0.3130 | 3.95e-11 | 5ixh:A |
8 | 1u02:A | 229 | 72 | 0.1420 | 0.1092 | 0.3472 | 2.6 | |
9 | 4ihb:E | 126 | 48 | 0.0739 | 0.1032 | 0.2708 | 5.1 | 7jof:A, 7jof:B, 7jof:C, 7jof:D |
10 | 7oyc:E1 | 214 | 21 | 0.0682 | 0.0561 | 0.5714 | 5.3 |