BioLiP

>protein
MKVRIATYASHSALQILKGAKDEGFETIAFGSSKVKPLYTKYFPVADYFIEEKYPEEELLNLNAVVVPTGSFVAHLGIEL
VENMKVPYFGNKRVLRWESDRNLERKWLKKAGIRVPEVYEDPDDIEKPVIVKPKGYFLAKDPEDFWRKAEKFLIQIQEYV
LGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAA
EELMGGLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT

The query sequence (length=318) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2r86:A	334	334	1.0000	0.9521	0.9521	0.0	2r84:A, 2r85:A, 2r85:B, 2r86:B, 2r87:A, 2r87:B, 2r87:C, 2r87:D, 2r87:E, 2r87:F
2	2r84:B	313	318	0.9843	1.0000	0.9843	0.0
3	2r7k:A	358	342	0.5063	0.4497	0.4708	3.26e-104	2r7l:A, 2r7m:A, 2r7n:A
4	2pbz:A	293	316	0.3868	0.4198	0.3892	5.05e-51	2pbz:B, 2pbz:C
5	3r5x:C	284	124	0.0943	0.1056	0.2419	0.15
6	3dtf:A	363	83	0.0503	0.0441	0.1928	0.83	3dtf:B, 3dtg:A, 3dtg:B, 3jz6:A, 3jz6:B
7	2k5c:A	88	32	0.0377	0.1364	0.3750	1.3
8	6ei3:A	511	127	0.1038	0.0646	0.2598	5.0
9	4ruq:B	237	33	0.0314	0.0422	0.3030	5.8	4ruq:A, 4rus:A, 4rus:B, 4rus:C, 4rus:D, 4rus:E, 4rus:F
10	8iqi:C	916	28	0.0346	0.0120	0.3929	9.2	8iqc:A, 8iqc:B, 8iqd:A, 8iqd:B, 8iqd:C, 8iqd:D, 8iqi:A, 8iqi:B, 8iqi:D, 8iqi:E, 8iqi:F

[Back]