BioLiP

>protein
MKVPEAAISRLITYLRILEELEAQGVHRTSSEQLGELAQVTAFQVRKDLSYFGSYGTRGVGYTVPVLKRELRHILGLNRK
WGLCIVGMGRLGSALADYPGFGESFELRGFFDVDPEKVGRPVRGGVIEHVDLLPQRVPGRIEIALLTVPREAAQKAADLL
VAAGIKGILNFAPVVLEVPKEVAVENVDFLAGLTRLSFAILNPKWR

The query sequence (length=206) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2dt5:B	211	206	0.9951	0.9716	0.9951	7.06e-148	2dt5:A, 3ikt:A, 3ikt:B, 3il2:A, 3il2:B, 1xcb:A, 1xcb:B, 1xcb:C, 1xcb:D, 1xcb:E, 1xcb:F, 1xcb:G
2	5zz7:A	206	203	0.4320	0.4320	0.4384	4.41e-46	7wb3:A, 7wb3:B, 5zz6:A, 5zz6:B, 5zz6:C, 5zz6:D, 5zz7:B
3	2vt3:B	208	198	0.3544	0.3510	0.3687	5.53e-38	2vt2:A, 2vt2:B, 2vt3:A
4	3wgi:A	217	198	0.4029	0.3825	0.4192	7.05e-38	3wgg:A, 3wgg:B, 3wgh:A, 3wgh:B, 3wgi:B, 3wgi:C, 3wgi:D
5	3keo:B	207	202	0.3495	0.3478	0.3564	7.33e-35	3keo:A, 3keq:A, 3keq:B, 3ket:A
6	3e18:A	348	109	0.1214	0.0718	0.2294	0.061	3e18:B
7	7xdu:B	348	34	0.0631	0.0374	0.3824	1.3	7xdu:A
8	6sy0:A	137	42	0.0728	0.1095	0.3571	1.6	6sy0:B
9	1o5k:A	295	57	0.0922	0.0644	0.3333	2.0
10	6xqn:C	154	43	0.0777	0.1039	0.3721	5.0	6x4s:A, 6x4s:B, 6x4s:C, 6x4s:D, 6xqn:D
11	3wv5:A	387	29	0.0631	0.0336	0.4483	6.7	3wvn:A
12	2fdc:A	505	84	0.0971	0.0396	0.2381	7.3
13	5f9t:A	659	35	0.0631	0.0197	0.3714	8.5	5f9t:B, 4yw1:A, 4yw1:B, 4yw2:A, 4yw2:B, 4yw3:A, 4yw3:B, 4yw5:A, 4yw5:B, 4yz2:A, 4yz2:B, 4yz3:A, 4yz3:B, 4yz4:A, 4yz4:B, 4yz5:A, 4yz5:B
14	5m45:B	709	83	0.1117	0.0324	0.2771	9.0	5m45:E, 5m45:H, 5m45:K, 5svb:B, 5svb:E

[Back]