MKVKQLEDAVEELLSANYHLENAVARLKKLVGER
The query sequence (length=34) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3crp:B | 34 | 34 | 1.0000 | 1.0000 | 1.0000 | 6.31e-18 | 2b1f:A, 2b1f:C, 3crp:C |
2 | 1ysa:C | 57 | 33 | 0.8235 | 0.4912 | 0.8485 | 8.73e-14 | 1dgc:A, 2dgc:A, 1ysa:D |
3 | 1llm:C | 87 | 28 | 0.7353 | 0.2874 | 0.8929 | 4.80e-11 | 1llm:D |
4 | 3i5c:B | 198 | 30 | 0.7353 | 0.1263 | 0.8333 | 2.86e-10 | 3i5c:A, 1ij0:A, 1ij0:B, 1ij0:C, 1ij1:A, 1ij1:B, 1ij1:C, 3k7z:A, 3k7z:B, 1rb4:A, 1rb4:B, 1swi:C, 6xne:C |
5 | 5apw:B | 64 | 29 | 0.7059 | 0.3750 | 0.8276 | 2.98e-09 | |
6 | 5apw:B | 64 | 32 | 0.6765 | 0.3594 | 0.7188 | 5.39e-09 | |
7 | 2bni:C | 34 | 33 | 0.5294 | 0.5294 | 0.5455 | 3.59e-08 | 2bni:D, 1u9h:A |
8 | 1uo4:B | 31 | 31 | 0.5588 | 0.6129 | 0.6129 | 8.83e-08 | 1uo5:A |
9 | 1fav:A | 78 | 28 | 0.5000 | 0.2179 | 0.6071 | 9.96e-08 | 6j5e:G, 6tvq:AaA, 6tvu:AaA, 6tvw:CCC, 3vgx:C, 3vu5:A, 3vu6:A, 3w19:C, 5yb4:E, 5yb4:F, 5yb4:D |
10 | 1uny:B | 30 | 30 | 0.5000 | 0.5667 | 0.5667 | 4.80e-06 | |
11 | 2r2v:C | 33 | 33 | 0.5000 | 0.5152 | 0.5152 | 1.27e-04 | 2r2v:D |
12 | 1czq:A | 45 | 30 | 0.4118 | 0.3111 | 0.4667 | 1.92e-04 | 1gzl:A, 1gzl:B, 3l35:A, 3l35:C, 3l35:B, 3l36:A, 3l37:A, 3mgn:D, 3mgn:F, 3mgn:A, 3mgn:C, 3mgn:E, 3mgn:B, 6psa:A, 2q3i:A, 2r3c:A, 2r3c:B, 2r5b:A, 2r5b:C, 2r5b:B, 2r5d:A, 2r5d:C, 2r5d:B |
13 | 4hjb:C | 30 | 31 | 0.4118 | 0.4667 | 0.4516 | 0.016 | 4hjb:D |
14 | 3w8v:A | 32 | 32 | 0.5000 | 0.5312 | 0.5312 | 0.076 | 3w8v:B, 3w92:A, 3w92:B, 3w92:C, 3w93:A, 3w93:B, 3w93:C |
15 | 6lyh:A | 358 | 24 | 0.3235 | 0.0307 | 0.4583 | 0.64 | 6lyh:B, 6lyh:C, 6lyh:D, 6lyh:E, 6lyh:F, 6lyh:G, 6lyh:H |
16 | 8tj5:0 | 1246 | 19 | 0.2941 | 0.0080 | 0.5263 | 1.3 | 8tj5:Y |
17 | 8ofi:C | 415 | 22 | 0.2647 | 0.0217 | 0.4091 | 7.2 | |
18 | 8ofi:A | 452 | 22 | 0.2647 | 0.0199 | 0.4091 | 7.2 | |
19 | 6gyo:A | 501 | 22 | 0.2647 | 0.0180 | 0.4091 | 7.2 | 3etq:A, 3etq:B, 6gyo:B, 6gyo:C, 6gyo:D, 4hbn:A, 4kl1:A, 4kl1:B, 4kl1:C, 4kl1:D, 7np4:A, 7np4:B, 7np4:C, 7np4:D, 4nvp:A, 3otf:A, 3u11:A, 3u11:B |
20 | 8inz:C | 465 | 22 | 0.2647 | 0.0194 | 0.4091 | 9.6 | 8inz:A, 8inz:B, 8inz:D, 8io3:C, 8io3:A, 8io3:B, 8io3:D |